1. Membrane Transporter/Ion Channel
  2. Potassium Channel
  3. ADWX 1

ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases.

For research use only. We do not sell to patients.

ADWX 1 Chemical Structure

ADWX 1 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases[1][2].

IC50 & Target[1]

Kv1.3

1.89 pM (IC50)

Kv1.1

0.65 nM (IC50)

In Vitro

ADWX 1 (1,10 nM, 1 h) inhibits IL-2 and IFN-γ productions, and inhibits humans CD4+ CCR7- TEM cells activation selectively[2].
ADWX 1 (1,10 nM, 50 min) reduces [Ca2+] in activated CD4+ CCR7- TCM cells from EAE rats[2].
ADWX 1 (1,10 nM, 1 h) reduces NF-κB activation and suppresses Kv1.3 expression at both mRNA and protein levels preferentially in myelin basic protein (MBP) (HY-P77995)-stimulated CD4+ CCR7- T cells from EAE rats[2].
ADWX 1 (1,10 nM, 3 days) suppresses Th17 activation but not differentiation in CD4+ CCR7- T cells[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

RT-PCR[2]

Cell Line: CD4+ CCR7- T cells from EAE rats
Concentration: 1, 10 nM
Incubation Time: 1 h
Result: Suppressed Kv1.3 gene mRNA expression preferentially.

Western Blot Analysis[2]

Cell Line: CD4+ CCR7- T cells from EAE rats
Concentration: 1, 10 nM
Incubation Time: 1 h
Result: Suppressed Kv1.3 protein expression preferentially.
In Vivo

ADWX 1 (100 μg/kg/day, s.c., 3 days) ameliorates the disease through the inhibition of IL-2 and IFN-γ productions and CCR7- TEM proliferation in experimental autoimmune encephalomyelitis (EAE) of Sprague-Dawley rats[2].
ADWX 1 (5/10 mg/kg, s.c., 2 weeks) induces no pathological changes in the behavior or tissues of the rats (acute toxicity assay)[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Stable symptoms of acute experimental autoimmune encephalomyelitis (EAE) were induced by immunizing Sprague-Dawley rats[2].
Dosage: 100 μg/kg/day, 3 days
Administration: subcutaneous injection (s.c.)
Result: Reduced neurological scores compared with vehicle-treated rats on days 10, 11, 12, 13 and 14.
Reduced in inflammatory infiltrates and demyelination in the affected spinal cord significantly.
Inhibited IL-2 and IFN-γ productions.
Inhibited the T cell proliferation triggered by high and low concentrations of myelin antigen in a dose-dependent manner.
Decreased CD4+ CCR7- TEM cells.
Molecular Weight

4071.85

Formula

C169H281N57O46S7

Unlabeled CAS

Sequence

Val-Gly-Ile-Asn-Val-Lys-Cys-Lys-His-Ser-Arg-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Thr-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bonds: Cys7-Cys27, Cys13-Cys32, Cys17-Cys34)

Sequence Shortening

VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Disulfide bonds: Cys7-Cys27, Cys13-Cys32, Cys17-Cys34)

SMILES

O=C(NCC(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(N)=O)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(N[C@@H](CSSC[C@@H](C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(N)=O)C(NCC(N[C@H]1CCCCN)=O)=O)=O)=O)NC2=O)C(N[C@@H](CCCCN)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CSSC[C@@H](C(N[C@H]4CC5=CNC=N5)=O)NC1=O)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N6[C@@H](CCC6)C(N[C@@H](CSSC[C@@H](C(N[C@@H]([C@H](O)C)C(N7[C@@H](CCC7)C(N[C@@H](CCCCN)C(O)=O)=O)=O)=O)NC4=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(NCC(N[C@@H](CCSC)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC8=CC=CC=C8)C(NCC(N[C@H]2CCCCN)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](C(C)C)N

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADWX 1
Cat. No.:
HY-P1409
Quantity:
MCE Japan Authorized Agent: