1. GPCR/G Protein Neuronal Signaling
  2. CGRP Receptor
  3. Calcitonin (salmon) (acetate)

Calcitonin (salmon) (acetate)  (Synonyms: Salmon calcitonin acetate)

Cat. No.: HY-P0090A
Handling Instructions

Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption.The acetate form can affect the absorption and efficacy of hormones.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Calcitonin (salmon) (acetate) Chemical Structure

Calcitonin (salmon) (acetate) Chemical Structure

CAS No. : 158000-61-4

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Calcitonin (salmon) (acetate):

Other Forms of Calcitonin (salmon) (acetate):

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Calcitonin (salmon) (acetate)

WB

    Calcitonin (salmon) (acetate) purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2020 Aug;24(15):8650-8661.  [Abstract]

    Calcitonin increases phosphorylated PKC-ε but reduces phosphorylated PKC-δ, which are antagonistic to the effects of IL-1 treatment.
    • Biological Activity

    • Purity & Documentation

    • References

    • Customer Review

    Description

    Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption[1].The acetate form can affect the absorption and efficacy of hormones[2].

    Molecular Weight

    3431.85 (free base)

    Formula

    C145H240N44O48S2.xC2H4O2

    CAS No.
    Unlabeled Cas

    Sequence

    Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)

    Sequence Shortening

    CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7)

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Storage

    Please store the product under the recommended conditions in the Certificate of Analysis.

    Purity & Documentation
    References
    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.

    Calcitonin (salmon) (acetate) Related Classifications

    • Molarity Calculator

    • Dilution Calculator

    The molarity calculator equation

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass   Concentration   Volume   Molecular Weight *
    = × ×

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Salutation

    Applicant Name *

     

    Email Address *

    Phone Number *

     

    Organization Name *

    Department *

     

    Requested quantity *

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Calcitonin (salmon) (acetate)
    Cat. No.:
    HY-P0090A
    Quantity:
    MCE Japan Authorized Agent: