Defensin HNP-1 human 

Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities^[1][2].

3442.03

C₁₅₀H₂₂₂N₄₄O₃₈S₆

148093-65-6

Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

O=C([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@](NC([C@@]1([H])NC([C@](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@](NC([C@]2([H])CSSC[C@](C(N[C@@H](CSSC[C@@H](C(N[C@H](C(N[C@](CSSC1)([H])C(N[C@H](C(N[C@@](C(N3[C@](CCC3)([H])C(N[C@H](C(N2)=O)C)=O)=O)([H])[C@@H](C)CC)=O)CCCNC(N)=N)=O)=O)CC4=CC=C(C=C4)O)=O)NC([C@@H](N)C)=O)C(O)=O)=O)([H])NC([C@@H](NC([C@@H](NC5=O)C)=O)CC6=CC=CC=C6)=O)=O)([H])[C@@H](C)CC)=O)C)=O)=O)CCC(O)=O)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)CC7=CC=C(C=C7)O)=O)=O)([H])[C@H](O)C)=O)=O)([H])[C@@H](C)CC)=O)CC8=CC=C(C=C8)O)=O)CCC(N)=O)=O)=O)CCCNC(N)=N)=O)CC(C)C)N[C@H]5CC9=CNC%10=CC=CC=C9%10

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Dabirian S, et, al. Human neutrophil peptide-1 (HNP-1): a new anti-leishmanial drug candidate. PLoS Negl Trop Dis. 2013 Oct 17;7(10):e2491.  [Content Brief]

  [2]. Higazi M, et, al. Opposing effects of HNP1 (α-defensin-1) on plasma cholesterol and atherogenesis. PLoS One. 2020 Apr 17;15(4):e0231582.  [Content Brief]