1. GPCR/G Protein
  2. PACAP Receptor
  3. PACAP (1-38) free acid

PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1.

For research use only. We do not sell to patients.

PACAP (1-38) free acid Chemical Structure

PACAP (1-38) free acid Chemical Structure

CAS No. : 129405-61-4

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of PACAP (1-38) free acid:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1[1][2].

In Vitro

PACAP (1-38) free acid (1 nM) increases substance P, gastrin releasing peptide and vasoactive intestinal polypeptide release[1].
PACAP (1-38) free acid (100 nM; 10 min) induces tyrosine phosphorylation of NR2B in rat hippocampal slices[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis[2]

Cell Line: Rat hippocampal slices
Concentration: 100 nM
Incubation Time: 10 min
Result: Caused an enhancement of tyrosine phosphorylation of NR2B.
Molecular Weight

4535.24

Formula

C203H330N62O54S

CAS No.
Unlabeled CAS

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys

Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

SMILES

O=C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CO)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC3=CC=C(C=C3)O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCSC)C(N[C@@H](C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CC4=CC=C(C=C4)O)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](C(C)C)C(N[C@@H](CC(C)C)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC5=CC=C(C=C5)O)C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCCN)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC6=CNC=N6)N

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PACAP (1-38) free acid
Cat. No.:
HY-P0221C
Quantity:
MCE Japan Authorized Agent: