2. Vitamin D Related/Nuclear Receptor
  3. Thyroid Hormone Receptor
  4. Parathyroid hormone (1-34) (rat)

Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis.

For research use only. We do not sell to patients.

Parathyroid hormone (1-34) (rat) Chemical Structure

Parathyroid hormone (1-34) (rat) Chemical Structure

CAS No. : 98614-76-7

Size Price Stock
1 mg USD 260 Ask For Quote & Lead Time
5 mg USD 730 Ask For Quote & Lead Time

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Parathyroid hormone (1-34) (rat):

Other Forms of Parathyroid hormone (1-34) (rat):

Parathyroid hormone (1-34) (rat) Related Antibodies

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Parathyroid hormone (1-34) (rat)

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis[1][2].

In Vivo

Parathyroid hormone (1-34) (rat) (s.c; 40 mg/kg; per day; for 4 weeks) promotes the formation of bone[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: ovariectomized (Ovx) rats[1]
Dosage: 40 mg/kg
Administration: s.c, per day, for 4 weeks
Result: Preserved Cn-BV/TV and trabecular connectivity, and combined estrogen and PTH caused a 40% increment in Cn-BV/TV while maintaining comparable trabecular connectivity with that seen in the Shamoperated animals.
Prevented further loss of connectivity and Cn-BV/TV, and combined estrogen and PTH resulted in as much as a 300% improvement in one of the parameters of trabecular connectivity, node to node strut length, and a 106% increase in Cn-BV/TV, with respect to the bone status at the initiation of treatment.
Molecular Weight

4057.71

Formula

C180H291N55O48S2
CAS No.
Unlabeled CAS

Appearance

Solid

Color

Off-white to light yellow

Sequence

Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Sequence Shortening

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
SMILES

O=C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CCC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CCSC)C(N[C@@H](CC1=CNC=N1)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CC2=CNC=N2)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](CO)C(N[C@@H](C(C)C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCSC)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC3=CNC4=CC=CC=C34)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CC5=CNC=N5)C(N[C@@H](CC(N)=O)C(N[C@@H](CC6=CC=CC=C6)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](C)N
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Parathyroid hormone (1-34) (rat) Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Parathyroid hormone (1-34) (rat)98614-76-7Thyroid Hormone ReceptorTHRparathyroid hormone (PTH)corticalcancellous bone structureInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Parathyroid hormone (1-34) (rat)
Cat. No.:
HY-P2279
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.