1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands RANKL/CD254
  5. RANKL
  6. Animal-Free RANK L/TNFSF11 Protein, Mouse (His)

Animal-Free RANK L/TNFSF11 Protein, Mouse (His)

Cat. No.: HY-P700226AF
COA Handling Instructions

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). Animal-Free RANK L/TNFSF11 Protein, Mouse (His) is a recombinant mouse RANKL (P143-D316) with C-terminal His tag, which is produced in E.coli.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $95 In-stock
10 μg $265 In-stock
50 μg $740 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). Animal-Free RANK L/TNFSF11 Protein, Mouse (His) is a recombinant mouse RANKL (P143-D316) with C-terminal His tag, which is produced in E.coli[1][2].

Background

RANKL (TNFSF11) belongs to TNF family. RANKL is a type II transmembrane protein and is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. RANKL binds to RANK and induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. In bone tissue, RANKL is expressed by osteoblasts, osteocytes and immune cells, especially in osteoblasts and osteocytes[1]. RANKL is also expressed by T cells and increases proliferation and survival of dendritic cells[2]. In mice, RANKL/RANK signaling attenuates inflammation in ischemic brains through a Toll-like receptor signaling pathway[4].
RANKL consists of cytoplasmic domain (1-47), helical domain (48-68), and extracellular domain (69-317). The soluble chain (140-317) is released when cleaved by enzymes such as matrix metalloproteinases (MMP3 or 7) and ADAM[1][3].
RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs)[1].

In Vitro

RANKL (mouse, 3 ng/mL, 4 days) induces osteoclast differentiation from RAW264.7 cells, and can be inhibited by Resveratrol[5].
RANKL (mouse,1 ng/mL, -3 h) induces NF-κB activation in murine hepatocyte cell line (AML-12) [6].

In Vivo

RANKL (mouse, i.c.v., 5 ng in 2 μL) reduces IL-1β, MCP-1, IL-6 and TNFα expression in WT mice[4].
RANKL (mouse, i.p., 1-1 μg) protects against hepatic ischemia/reperfusion liver injury in mice[6].

Biological Activity

Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is <2 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

O35235 (P143-D316)

Gene ID
Molecular Construction
N-term
RANKL (P143-D316)
Accession # O35235
His
C-term
Synonyms
soluble Receptor Activator of NF-kB Ligand; TNFSF11; TRANCE (TNF-Related Activation-induced Cytokine); OPGL; ODF (Osteoclast Differentiation Factor); CD254; sRNAK Ligand
AA Sequence

MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Weight

Approximately 20.35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free RANK L/TNFSF11 Protein, Mouse (His)
Cat. No.:
HY-P700226AF
Quantity:
MCE Japan Authorized Agent: