1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Nerve Growth Factor-β (Beta-NGF)
  6. Beta-NGF Protein, Mouse (110a.a, His)

Beta-NGF Protein, Mouse (110a.a, His)

Cat. No.: HY-P70530A
COA Handling Instructions

Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes. The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. Beta-NGF Protein, Mouse (110a.a, His) is the recombinant mouse-derived Beta-NGF protein, expressed by E. coli , with N-6*His labeled tag. The total length of Beta-NGF Protein, Mouse (110a.a, His) is 110 a.a., with molecular weight of ~12.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $59 In-stock
50 μg $165 In-stock
100 μg $280 In-stock
500 μg $760 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes. The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. Beta-NGF Protein, Mouse (110a.a, His) is the recombinant mouse-derived Beta-NGF protein, expressed by E. coli , with N-6*His labeled tag. The total length of Beta-NGF Protein, Mouse (110a.a, His) is 110 a.a., with molecular weight of ~12.0 kDa.

Background

Beta-NGF, a pivotal factor in the development and maintenance of the sympathetic and sensory nervous systems, acts as an extracellular ligand for the NTRK1 and NGFR receptors, triggering cellular signaling cascades that regulate neuronal proliferation, differentiation, and survival. The immature NGF precursor (proNGF) serves as a ligand for the heterodimeric receptor formed by SORCS2 and NGFR, inducing signaling cascades that result in the inactivation of RAC1 and/or RAC2, along with the reorganization of the actin cytoskeleton and subsequent neuronal growth cone collapse. In contrast to mature NGF, proNGF has been identified to promote neuronal apoptosis in vitro. Additionally, Beta-NGF inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binding to lysophosphatidylinositol and lysophosphatidylserine within its homodimeric structure, Beta-NGF exhibits diverse functions in cellular responses, including promoting histamine release from mast cells when in its lipid-bound form. The homodimeric structure of Beta-NGF interacts with NTRK1, NGFR, and SORCS2, while the NGF precursor (proNGF) binds to a receptor complex formed by SORT1 and NGFR, leading to NGF endocytosis. These intricate interactions underscore the multifaceted roles of Beta-NGF in orchestrating neuronal functions and cellular responses.

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 9.125 ng/mL, corresponding to a specific activity is 1.095×10^5 units/mg.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P01139 (M130-R239)

Gene ID

18049

Molecular Construction
N-term
6*His
Beta-NGF (M130-R239)
Accession # P01139
C-term
Synonyms
Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB
AA Sequence

MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

Molecular Weight

Approximately 12.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 200 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Beta-NGF Protein, Mouse (110a.a, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Beta-NGF Protein, Mouse (110a.a, His)
Cat. No.:
HY-P70530A
Quantity:
MCE Japan Authorized Agent: