1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. B Cell CD Proteins NK Cell CD Proteins Stem Cell CD Proteins Receptor Tyrosine Kinases
  4. CD117/c-KIT
  5. CD117/c-kit Protein, Rat (HEK293, His)

CD117/c-kit Protein, Rat (HEK293, His)

Cat. No.: HY-P74337
COA Handling Instructions

CD117, also known as tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR), is a cytokine receptor that is expressed on the surface of hematopoietic stem cells and other cell types. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 is a proto-oncogene associated with tumor development. CD117/c-kit Protein, Rat (HEK293, His) is the recombinant rat-derived CD117/c-kit protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD117, also known as tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR), is a cytokine receptor that is expressed on the surface of hematopoietic stem cells and other cell types. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 is a proto-oncogene associated with tumor development. CD117/c-kit Protein, Rat (HEK293, His) is the recombinant rat-derived CD117/c-kit protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD117 protein is a protein encoded by the proto-oncogene c-KIT, also known as the tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR). CD117 is a cytokine receptor expressed on the surface of hematopoietic stem cells and other cell types. Altered forms of this receptor may be associated with certain types of cancer. CD117 is a receptor tyrosine kinase type III that binds to stem cell factors to form a dimer that activates its inherent tyrosine kinase activity, which in turn phosphorylates and activates signal transduction molecules that propagate signals through the cell. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 signaling is necessary for the survival of melanocytes, and it is also involved in hematopoiesis and gametogenesis[1][2][3][4].

Species

Rat

Source

HEK293

Tag

C-10*His

Accession

Q63116 (Q26-T522)

Gene ID
Molecular Construction
N-term
KIT (M1-T522)
Accession # Q63116
His
C-term
Synonyms
Mast/stem cell growth factor receptor Kit; SCFR; CD117; Kit; Sl
AA Sequence

QPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTDPAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLVGLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYHRLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVSTSVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGSANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNRGEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTYDRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSIDSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHT

Molecular Weight

Approximately 60-110 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD117/c-kit Protein, Rat (HEK293, His)
Cat. No.:
HY-P74337
Quantity:
MCE Japan Authorized Agent: