1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled-10/CD350 Frizzled
  5. Frizzled-10
  6. Frizzled-10/CD350 Protein, Mouse (HEK293, His)

Frizzled-10/CD350 Protein, Mouse (HEK293, His)

Cat. No.: HY-P74144
COA Handling Instructions

Frizzled-10/CD350 protein is a receptor for Wnt proteins that functions in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target gene activation. Secondary signaling pathways involve PKC and calcium flux. Frizzled-10/CD350 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag. The total length of Frizzled-10/CD350 Protein, Mouse (HEK293, His) is 141 a.a., with molecular weight of 20-24 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $46 In-stock
10 μg $75 In-stock
50 μg $215 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Frizzled-10/CD350 Protein, Mouse (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frizzled-10/CD350 protein is a receptor for Wnt proteins that functions in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target gene activation. Secondary signaling pathways involve PKC and calcium flux. Frizzled-10/CD350 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag. The total length of Frizzled-10/CD350 Protein, Mouse (HEK293, His) is 141 a.a., with molecular weight of 20-24 kDa.

Background

Frizzled-10/CD350 Protein operates as a receptor for Wnt proteins, functioning primarily in the canonical Wnt/beta-catenin signaling pathway. This pathway orchestrates the activation of disheveled proteins, inhibits GSK-3 kinase, facilitates nuclear accumulation of beta-catenin, and triggers the activation of Wnt target genes. Alongside the canonical pathway, a secondary signaling route involving PKC and calcium fluxes has been identified for some family members. The interplay between these pathways and their potential integration remains to be fully elucidated, given PKC's apparent role in Wnt-mediated inactivation of GSK-3 kinase. Frizzled-10 may play a crucial role in transducing and transmitting polarity information during tissue morphogenesis or within differentiated tissues. Interactions with MYOC and WNT7B underscore its involvement in intricate cellular processes and signal transduction cascades.

Biological Activity

Measured by its ability to bind biotinylated recombinant mouse Wnt-3a in a functional ELISA. The ED50 for this effect is 38.32 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8BKG4/NP_780493.1(I22-G162)

Gene ID

93897  [NCBI]

Molecular Construction
N-term
CD350 (I22-G162)
Accession # Q8BKG4/NP_780493.1
His
C-term
Synonyms
CD350 antigen; CD350; Frizzled-10; FZ-10; FZD10
AA Sequence

ISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRG

Molecular Weight

Approximately 20-24 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-10/CD350 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74144
Quantity:
MCE Japan Authorized Agent: