1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Growth Differentiation Factor GDNF family
  5. Growth Differentiation Factor 15 (GDF-15)
  6. GDF-15 Protein, Mouse (HEK293, His-Flag)

GDF-15 Protein, Mouse (HEK293, His-Flag)

Cat. No.: HY-P700293
COA Handling Instructions

GDF-15 Protein regulates food intake, energy balance, and body weight by binding to its receptor, GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering a 'emergency circuit' in the parabrachial nucleus and central amygdala during stress. GDF-15 also inhibits growth hormone signaling on hepatocytes and forms a disulfide-linked homodimer. Interacting with GFRAL, it acts as a ligand, facilitating GDF15 internalization and signaling through RET. GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293, with N-8*His, N-Flag labeled tag. The total length of GDF-15 Protein, Mouse (HEK293, His-Flag) is 115 a.a., with molecular weight of 14-16 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $139 In-stock
50 μg $390 Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GDF-15 Protein regulates food intake, energy balance, and body weight by binding to its receptor, GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering a 'emergency circuit' in the parabrachial nucleus and central amygdala during stress. GDF-15 also inhibits growth hormone signaling on hepatocytes and forms a disulfide-linked homodimer. Interacting with GFRAL, it acts as a ligand, facilitating GDF15 internalization and signaling through RET. GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293, with N-8*His, N-Flag labeled tag. The total length of GDF-15 Protein, Mouse (HEK293, His-Flag) is 115 a.a., with molecular weight of 14-16 kDa.

Background

GDF-15 Protein plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It accomplishes this by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons located in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons within the parabrachial nucleus and central amygdala, which are part of the 'emergency circuit' responsible for shaping feeding responses in stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes and forms a homodimer that is disulfide-linked. It also interacts with GFRAL, acting as a ligand to facilitate GDF15 internalization and cellular signaling through its interaction with RET.

Species

Mouse

Source

HEK293

Tag

N-8*His;N-Flag

Accession

Q9Z0J7 (S189-A303)

Gene ID

23886  [NCBI]

Molecular Construction
N-term
8*His-Flag
GDF-15 (S189-A303)
Accession # Q9Z0J7
C-term
Synonyms
Growth Differentiation Factor 15; Macrophage inhibitory cytokine 1; GDF-15; MIC-1; NAG-1; PLAB; PTGFB; Gdf15; Sbf
AA Sequence

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Weight

14-16 KDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Endotoxin Level

Less than 1 EU/µg as determined by LAL test.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-15 Protein, Mouse (HEK293, His-Flag)
Cat. No.:
HY-P700293
Quantity:
MCE Japan Authorized Agent: