1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. Interleukin & Receptors T Cell CD Proteins NK Cell CD Proteins Endothelial cell CD Proteins
  4. IL-18 Receptor CD218a/IL-18R alpha
  5. IL-18R alpha
  6. IL-18R alpha Protein, Rat (HEK293, His)

IL-18R alpha Protein, Rat (HEK293, His)

Cat. No.: HY-P76424
COA Handling Instructions

IL-18R alpha (interleukin-18 receptor alpha) is an interleukin receptor of the immunoglobulin superfamily. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of nuclear factor kβ. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18. IL-18R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 326 amino acids (M1-G326) and is produced by HEK293 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-18R alpha (interleukin-18 receptor alpha) is an interleukin receptor of the immunoglobulin superfamily. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines[1]. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of nuclear factor kβ[2]. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18[3]. IL-18R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 326 amino acids (M1-G326) and is produced by HEK293 cells.

Background

IL-18R alpha is expressed on CD4+ and CD8+ T cells but not expressed on naive T cells[4].
The amino acid sequence of human IL-18R alpha protein has low homology for mouse IL-18R alpha protein.
IL-18R alpha is the receptor of IL-18. IL-18 is extracellularly secreted and binds IL-18 receptor α (Rα) as well as IL-18 receptor β (Rβ) at the immunocyte plasma membrane in a stepwise manner. IL-18/IL-18Rα/IL-18Rβ ternary complex formation juxtaposes the intracellular Toll-Interleukin-1 receptor domains of IL-18Rα and IL-18Rβ. Then, the adaptor molecule myeloid differentiation factor 88 (MyD88) is recruited presumably with the aid of TRAM. MyD88 further interacts with IL-1 receptor associating kinase (IRAK) 4 and IRAK1/2 to form the large molecular assembly referred to as Myddosome, which subsequently activates IKK via TRAF6. Finally, the signal activates the NF-κB and mitogen-activated protein kinase pathways7, which upregulate the expression of various inflammatory cytokines[1].
IL-18R alpha binds to IL-18 and IL-18 receptor β forms a signalling complex induces the expression of various inflammatory cytokines[1]. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18[3].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-18R alpha Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Mouse IL-18 Protein. The ED50 for this effect is 1.3 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-18R alpha Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Mouse IL-18 Protein. The ED50 for this effect is 1.3 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

A0A8I6A1C2 (A18-G326)

Gene ID

301365  [NCBI]

Molecular Construction
N-term
IL-18Rα (A18-G326)
Accession # A0A8I6A1C2
His
C-term
Synonyms
Interleukin-18 receptor 1; IL-18R1; CDw218a; IL1RRP; IL-18R-alpha; CD218a
AA Sequence

APKSCIRRSQIHVVEGEPFYLKPCDMSAPMHNNETATMRWFKGNASHGYRELNMRSSPRIAFHGHALEFWPVELEDKGTYFSQVGNDRQNWTLNVTKRNKHSCFSEKLVTNRDVEVKKSLWITCENPSYGELINHTLLYKNCKEISKTPMILKDAEFGDEGYYSCVFSVHHNGQQYNITKTVNITVIEGNSKITPAIFGSKSAKVGVELGEDVELNCSAVLNRNDLFYWSIRKEDSLDPNVHEDRNETTWTFEGKLHASKILRIQKVTEKYLNVLYNCTVANEEATDTKSFILVRKETPDIQGHVFMRG

Molecular Weight

Approximately 55-75 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18R alpha Protein, Rat (HEK293, His)
Cat. No.:
HY-P76424
Quantity:
MCE Japan Authorized Agent: