1. Search Result
Search Result
Results for "

human monocytes

" in MedChemExpress (MCE) Product Catalog:

40

Inhibitors & Agonists

1

Biochemical Assay Reagents

11

Peptides

4

Natural
Products

2

Recombinant Proteins

5

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-148045

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR9-IN-1 is a potent and selective TLR9 inhibitor with an IC50 value of 7 nM for human TLR9. TLR9-IN-1 can be used for researching diseases associated with undesirable immune response .
    TLR9-IN-1
  • HY-P1117

    Formyl Peptide Receptor (FPR) Calcium Channel Neurological Disease Inflammation/Immunology
    MMK1 is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC50s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 is a potent chemotactic and calcium-mobilizing agonist. MMK1 potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 exerts anxiolytic-like activity .
    MMK1
  • HY-P1117A

    Formyl Peptide Receptor (FPR) Calcium Channel Neurological Disease Inflammation/Immunology
    MMK1 TFA is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC50s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 TFA is a potent chemotactic and calcium-mobilizing agonist. MMK1 TFA potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 TFA exerts anxiolytic-like activity .
    MMK1 TFA
  • HY-P2311

    Endogenous Metabolite Antibiotic
    Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.
    Defensin HNP-2 human
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Others
    Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
    Met-RANTES (human)
  • HY-152581

    Cannabinoid Receptor Inflammation/Immunology
    CB2R antagonist 3 is a selective antagonist of cannabinoid type 2 receptor (CB2R). CB2R antagonist 3 has high affinity for human CB2R and specific selectivity for CB1R. CB2R antagonist 3 can be combined with CB65 (HY-110047), the activator of CB2R. CB2R antagonist 3 effectively up-regulates the expression of anti-inflammatory cytokines and down-regulates the expression of pro-inflammatory cytokines .
    CB2R antagonist 3
  • HY-76383

    Others Metabolic Disease Inflammation/Immunology
    LR-90 is an advanced glycation end product (AGE) inhibitor, inhibits inflammatory responses in human monocytes . LR-90 is also used in the research of diabetic animal model .
    LR-90
  • HY-B0253
    Piroxicam
    1 Publications Verification

    CP-16171

    COX Inflammation/Immunology Cancer
    Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.
    Piroxicam
  • HY-156850

    HDAC Cancer
    ITF 3756 is a potent and selective HDAC6 inhibitor. ITF 3756 reduces in vitro the expression of PD-L1 on human monocytes and on CD8 T cells, and shows anti-tumor activity .
    ITF 3756
  • HY-N11906

    Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether

    Others Inflammation/Immunology
    Diayangambin (Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether) is a cell proliferation inhibitor with an IC50 value of 1.5 μM against human monocytes. Diayangambin also has immunosuppressive and anti-inflammatory effects .
    Diayangambin
  • HY-108661

    P2Y Receptor Inflammation/Immunology
    NF546 is a selective non-nucleotide P2Y11 agonist with a pEC50 of 6.27. NF546 stimulates release of interleukin-8 from human monocyte-derived dendritic cells .
    NF546
  • HY-108661A

    P2Y Receptor Inflammation/Immunology
    NF546 (hydrate) is a selective non-nucleotide P2Y11 agonist with a pEC50 of 6.27. NF546 (hydrate) stimulates release of interleukin-8 from human monocyte-derived dendritic cells .
    NF546 hydrate
  • HY-139414
    Lysophosphatidylcholines
    1 Publications Verification

    Interleukin Related p38 MAPK ERK Apoptosis Inflammation/Immunology
    Lysophosphatidylcholines is an orally active lysolipid and a component of oxidized low density lipoprotein (LDL). Lysophosphatidylcholines induces cell injury, the production of IL-1β and apoptosis. Lysophosphatidylcholines has a proactive effect on sepsis .
    Lysophosphatidylcholines
  • HY-15450A

    CCR Endocrinology
    INCB 3284 is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC50 of 3.7 nM. INCB 3284 can be used in the research of acute liver failure.
    INCB 3284
  • HY-106228

    Fungal Bacterial Glutathione Peroxidase Infection
    HLF1-11, a human lactoferrin-derived peptide, is a broad spectrum antimicrobial agent. HLF1-11 inhibits human MPO activity. HLF1-11 also directs GM-CSF-driven monocyte differentiation toward macrophages, and enhances immune responses .
    HLF1-11
  • HY-B0253S

    CP-16171 d3

    COX Inflammation/Immunology Cancer
    Piroxicam-d3 is deuterium labeled Piroxicam. Piroxicam is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively [1].
    Piroxicam-d3
  • HY-15450

    CCR Endocrinology
    INCB 3284 dimesylate is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC50 of 3.7 nM. INCB 3284 dimesylate can be used in the research of acute liver failure.
    INCB 3284 dimesylate
  • HY-106409
    Tefinostat
    1 Publications Verification

    CHR-2845

    HDAC Apoptosis Cancer
    Tefinostat (CHR-2845) is a monocyte/macrophage targeted histone deacetylase (HDAC) inhibitor. Tefinostat can be cleaved into active acid CHR-2847 by the intracellular esterase human carboxylesterase-1 (hCE-1). Tefinostat can be used for the research of leukaemias .
    Tefinostat
  • HY-B0253S1

    CP-16171-d4

    Isotope-Labeled Compounds COX Inflammation/Immunology Cancer
    Piroxicam-d4 is the deuterium labeled Piroxicam. Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.
    Piroxicam-d4
  • HY-129905

    LLOMe hydrochloride; Leu-Leu methyl ester hydrochloride; H-Leu-Leu-OMe hydrochloride

    Endogenous Metabolite Inflammation/Immunology
    L-Leucyl-L-Leucine methyl ester (LLOMe) hydrochloride, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrochloride also can induce endolysosomal pathway stress .
    L-Leucyl-L-Leucine methyl ester hydrochloride
  • HY-B0227S1

    RP-19583-d4

    COX Apoptosis Inflammation/Immunology
    Ketoprofen-d4 is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].
    Ketoprofen-d4
  • HY-B0227S

    RP-19583-d3

    COX Apoptosis Inflammation/Immunology
    Ketoprofen-d3 is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].
    Ketoprofen-d3
  • HY-129905A

    LLOMe hydrobromide; Leu-Leu methyl ester hydrobromide; H-Leu-Leu-OMe hydrobromide

    Endogenous Metabolite Inflammation/Immunology
    L-Leucyl-L-Leucine methyl ester (LLOMe) hydrobromide, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrobromide also can induce endolysosomal pathway stress .
    L-Leucyl-L-Leucine methyl ester hydrobromide
  • HY-P1846

    Notch Cancer
    Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of monocyte-derived human dendritic cells .
    Jagged-1 (188-204)
  • HY-B0227S2

    RP-19583-13C,d3

    Isotope-Labeled Compounds COX Apoptosis Inflammation/Immunology
    Ketoprofen- 13C,d3 is the 13C- and deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].
    Ketoprofen-13C,d3
  • HY-101448

    WAY-171318

    MMP Apoptosis Inflammation/Immunology Cancer
    TMI-1 is a potent inhibitor of disintegrin metalloenzyme 17 (ADAM17) and other MMPs. TMI-1 inhibits LPS-induced TNF-α secretion in human primary monocytes, and human whole blood . TMI-1 selectively induces caspase-dependent apoptosis in triple negative (TN) and ERBB2-overexpressing breast tumor cell lines .
    TMI-1
  • HY-P1846A
    Jagged-1 (188-204) (TFA)
    5 Publications Verification

    Notch Cancer
    Jagged-1 (188-204) TFA is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of monocyte-derived human dendritic cells .
    Jagged-1 (188-204) (TFA)
  • HY-12511
    SKF-86002
    2 Publications Verification

    p38 MAPK Inflammation/Immunology
    SKF-86002 is an orally active p38 MAPK inhibitor, with anti-inflammatory, anti-arthritic and analgesic activities. SKF-86002 inhibits lipopolysaccharide (LPS)-stimulate human monocyte IL-1 and TNF-α production (IC50 = 1 μM). SKF-86002 inhibits lipoxygenase- and cyclooxygenase-mediated metabolism of arachidonic acid .
    SKF-86002
  • HY-108641

    p38 MAPK Inflammation/Immunology
    SKF-86002 dihydrochloride is an orally active p38 MAPK inhibitor, with anti-inflammatory, anti-arthritic and analgesic activities. SKF-86002 dihydrochloride inhibits lipopolysaccharide (LPS)-stimulate human monocyte IL-1 and TNF-α production (IC50 = 1 μM). SKF-86002 dihydrochloride inhibits lipoxygenase- and cyclooxygenase-mediated metabolism of arachidonic acid .
    SKF-86002 dihydrochloride
  • HY-123016A

    Endogenous Metabolite Metabolic Disease
    (±)9-HODE cholesteryl ester is originally extracted from atherosclerotic lesions1 and shown to be produced by Cu2+-catalyzed oxidation of LDL.2 Later studies determined that 15-LO from rabbit reticulocytes and human monocytes were able to metabolize cholesteryl linoleate, a major component of LDL, to 9-HODE cholesteryl ester.
    (±)9-HODE cholesteryl ester
  • HY-145473

    15(S)-HETE-SAPE; 15(S)-Hydroxyeicosatetraenoic acid-SAPE; 1-Stearoyl-2-15(S)-HETE-sn-glycero-3-Phosphatidylethanolamine

    Others Metabolic Disease
    1-Stearoyl-2-15(S)-HETE-sn-glycero-3-PE is a phospholipid that contains stearic acid (HY-B2219) at the sn-1 position and 15(S)-HETE at the sn-2 position. It is formed in human peripheral monocytes activated by the calcium ionophore A23187 (HY-N6687) by direct oxidation of 1-stearoyl-2-arachidonoyl-sn-glycero-3-PE (SAPE) by 15-LO. Phosphoethanolamine (PE) HETEs (PE-HETEs), including 1-stearoyl-2-15(S)-HETE-sn-glycero-3-PE, are the main source of esterified HETE in ionophore-activated monocytes.
    1-Stearoyl-2-15(S)-HETE-sn-glycero-3-PE
  • HY-128171
    Diflapolin
    1 Publications Verification

    FLAP Epoxide Hydrolase Inflammation/Immunology
    Diflapolin is a highly active dual 5-lipoxygenase-activating protein (FLAP)/soluble epoxide hydrolase (sEH) inhibitor with marked anti-inflammatory efficacy and high target selectivity. Diflapolin inhibits 5-LOX product formation in intact human monocytes and neutrophils with IC50s of  30 and 170 nM, respectively, and suppressed the activity of isolated sEH (IC50=20 nM) .
    Diflapolin
  • HY-163280

    NAMPT Neurological Disease
    JGB-1-155 is a positive allosteric modulators (N-PAMs), which enhances the activity of nicotinamide phosphoribosyltransferase NAMPT with EC50 of 3.29 μM. JGB-1-155 counteracts the oxidative stress, through upregulating the NAD + in THP-1 human monocytes. JGB-1-155 attenuates TNFα-induced ROS in HT-22 cells .
    JGB-1-155
  • HY-N8501

    Others Infection
    Emestrin is a mycotoxin originally isolated from E. striata that has antimicrobial, immunomodulatory, and cytotoxic activities. It is active against the fungi C. albicans and C. neoformans, as well as the bacteria E. coli, S. aureus, and methicillin-resistant S. aureus (MRSA; IC50s=3.94, 0.6, 2.21, 4.55, and 2.21 μg/mL, respectively).2 Emestrin is a chemokine (C-C motif) receptor 2 (CCR2) antagonist (IC50=5.4 μM in a radioligand binding assay using isolated human monocytes).3 Emestrin (0.1 μg/mL) induces apoptosis in HL-60 cells. It induces heart, thymus, and liver tissue necrosis in mice when administered at doses ranging from 18 to 30 mg/kg.
    Emestrin
  • HY-156622

    HMC-C-01-A; MBS2320

    Mitochondrial Metabolism Cancer
    Leramistat (HMC-C-01-A; MBS2320) is a mitochondrial complex 1 inhibitor, involving in cell metabolism immune metabolism regulation. Leramistat also inhibits ATP production in Thp1 human monocytes (IC50: 0.63 μM). Leramistat inhibits atopic dermatitis and other skin diseases autoimmune diseases, inflammatory diseases, cancer; and also inhibits osteoclast mediated disease .
    Leramistat
  • HY-151547

    P2X Receptor Neurological Disease
    MRS4719 is a potent P2X4 receptor antagonist with an IC50 value of 0.503 μM for human P2X4 receptor. MRS4719 can reduce infarct volume and reduce brain atrophy, showing neuroprotective and neuro-rehabilitative activities in ischemic stroke model. MRS4719 also reduces ATP-induced [Ca 2+]i influx in primary human monocyte-derived macrophages. MRS4719 can be used to research ischemic stroke .
    MRS4719
  • HY-P2358

    Toll-like Receptor (TLR) Inflammation/Immunology
    PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .
    PSMα3
  • HY-113545

    9(R)-Hydroxyoctadecadienoic acid

    Endogenous Metabolite Metabolic Disease
    9(R)-HODE is a monohydroxy fatty acid and metabolite of linoleic acid. It is formed from linoleic acid by COX and lipoxygenase (LO).9(R)-HODE induces chemotaxis, increases the levels of chemokine (C-C motif) receptor 9 (CCR9) and chemokine (C-X-C motif) receptor 4 (CXCR4), and inhibits IL-6 release in primary human monocytes. It inhibits CD3α- and CD28-induced proliferation of isolated human peripheral blood lymphocytes when used at a concentration of 25 μg/mL.
    9(R)-HODE
  • HY-101188

    Histamine Receptor Infection
    INCB38579 is an orally active, highly brain penetrable, and selective histamine H4 receptor (HH4R) antagonist (hH4R IC50=4.8 nM, mH4R IC50=42 nM, rH4R IC50=32 nM). INCB38579 shows anti-inflammatory pain and anti-pruritic activities .
    INCB38579
  • HY-109014

    CMX-157

    HIV HBV Nucleoside Antimetabolite/Analog Infection
    Tenofovir exalidex (CMX157) is a lipid conjugate of the acyclic nucleotide analog Tenofovir with activity against both wild-type and antiretroviral drug-resistant HIV strains, including multidrug nucleoside/nucleotide analog-resistant viruses. Tenofovir exalidex is active against all major subtypes of HIV-1 and HIV-2 in fresh human PBMCs and against all HIV-1 strains evaluated in monocyte-derived macrophages, with EC50s ranging between 0.2 and 7.2 nM. CMX157 is orally available and has no apparent toxicity. Tenofovir exalidex also shows antiviral activity against HBV .
    Tenofovir exalidex

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: