Kurtoxin

Cat. No.: HY-P5869: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca²⁺ channel gating inhibitor with a K_d of 15 nM for Cav3.1 (α1G T-type) Ca²⁺ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca²⁺ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na⁺ channel.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Kurtoxin Chemical Structure

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca²⁺ channel gating inhibitor with a K_d of 15 nM for Cav3.1 (α1G T-type) Ca²⁺ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca²⁺ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na⁺ channel^[1].
IC₅₀ & Target	Kd: 15 nM (Cav3.1 (α1G T-type) Ca²⁺ channel)^[1]
Molecular Weight	7386.36
Formula	C₃₂₄H₄₇₈N₉₄O₉₀S₈
Sequence	Lys-Ile-Asp-Gly-Tyr-Pro-Val-Asp-Tyr-Trp-Asn-Cys-Lys-Arg-Ile-Cys-Trp-Tyr-Asn-Asn-Lys-Tyr-Cys-Asn-Asp-Leu-Cys-Lys-Gly-Leu-Lys-Ala-Asp-Ser-Gly-Tyr-Cys-Trp-Gly-Trp-Thr-Leu-Ser-Cys-Tyr-Cys-Gln-Gly-Leu-Pro-Asp-Asn-Ala-Arg-Ile-Lys-Arg-Ser-Gly-Arg-Cys-Arg-Ala (Disulfide bridge: Cys12-Cys61,Cys16-Cys37,Cys23-Cys44,Cys27-Cys46)
Sequence Shortening	KIDGYPVDYWNCKRICWYNNKYCNDLCKGLKADSGYCWGWTLSCYCQGLPDNARIKRSGRCRA (Disulfide bridge: Cys12-Cys61,Cys16-Cys37,Cys23-Cys44,Cys27-Cys46)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (261 KB) Handling Instructions (2659 KB)
References	[1]. Lee CW, et al. Solution structure of kurtoxin: a gating modifier selective for Cav3 voltage-gated Ca(2+) channels. Biochemistry. 2012 Mar 6;51(9):1862-73. [Content Brief]

Kurtoxin Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

KurtoxinCalcium ChannelSodium ChannelCa2+ channelsCa channelsNa channelsNa+ channelsParabuthus transvaalicusL-typeN-typeP-typeα1G T-typeInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name			Lot #
Applicant Name *			Email Address *
Phone Number			Department *
Organization Name *			Country or Region *
Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Kurtoxin

Kurtoxin Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review