Animal-Free AGER Protein, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free AGER Protein, Human (His) is 278 a.a., with molecular weight of ~30.94 kDa.

AGER Protein, a cell surface pattern recognition receptor, adeptly senses endogenous stress signals with a wide-ranging ligand repertoire, encompassing advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Accumulation of advanced glycosylation end products, especially prevalent in aging and diabetes, triggers inflammatory responses at various disease sites, including diabetes, vascular complications, neurodegenerative disorders, and cancers. RAGE, upon ligand binding, utilizes TIRAP and MYD88 as adapters to transduce signals, ultimately inducing inflammatory cytokines IL6, IL8, and TNFalpha through NF-kappa-B activation. Noteworthy interactions include S100A12-triggered cellular activation, S100B-induced apoptosis post-myocardial infarction, and the facilitation of amyloid-beta peptide translocation in cortical neurons. AGER also plays a role in endothelial albumin transcytosis with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability, and mediates the loading of HMGB1 in extracellular vesicles for hepatocyte pyroptosis via the NLRP3 inflammasome. Additionally, it promotes extracellular hypomethylated DNA uptake for the activation of inflammatory responses. The constitutive homodimeric and oligomeric forms, along with interactions with S100 proteins, APP, TIRAP, and HMGB1, highlight the intricate involvement of AGER Protein in various cellular processes and pathological conditions.

Human

E. coli

C-His

Q15109 (A23-S300)

177  [NCBI]

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Approximately 30.94 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.