AP-2 gamma/TFAP2C Protein, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag. The total length of AP-2 gamma/TFAP2C Protein, Human (His) is 96 a.a., with molecular weight of 12-14 kDa.

AP-2 gamma/TFAP2C protein serves as a sequence-specific DNA-binding factor, engaging with inducible viral and cellular enhancer elements to intricately regulate transcription of specific genes. Recognizing the consensus sequence 5'-GCCNNNGGC-3', AP-2 gamma activates genes crucial for diverse biological functions, spanning proper eye, face, body wall, limb, and neural tube development. Simultaneously, it exerts a suppressive influence on several genes, including MCAM/MUC18, C/EBP alpha, and MYC. This protein also plays a pivotal role in the MTA1-mediated epigenetic control of ESR1 expression in breast cancer. Operating as a dimer, AP-2 gamma can form homodimers or heterodimers with other members of the AP-2 family. Notably, it engages in various protein interactions, including those with WWOX, CITED4, UBE2I, KCTD1, CITED2, and MTA1, each contributing to the complex regulatory network governing transcriptional activity.

Human

E. coli

N-10*His

Q92754-1 (L128-V223)

7022  [NCBI]

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Approximately 10-14 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.