1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Translocases (EC 7)
  4. ATP1B2 Protein, Human (HEK293, His)

ATP1B2 Protein, Human (HEK293, His)

Cat. No.: HY-P75587
COA Handling Instructions

The ATP1B2 protein is the non-catalytic component of ATP hydrolase and promotes Na(+)/K(+) ion exchange across the plasma membrane. Its role is critical in mediating cell adhesion of neurons and astrocytes, promoting sticky cell interactions. ATP1B2 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B2 protein, expressed by HEK293 , with N-His labeled tag. The total length of ATP1B2 Protein, Human (HEK293, His) is 223 a.a., with molecular weight of 40-60 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $215 In-stock
100 μg $345 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ATP1B2 protein is the non-catalytic component of ATP hydrolase and promotes Na(+)/K(+) ion exchange across the plasma membrane. Its role is critical in mediating cell adhesion of neurons and astrocytes, promoting sticky cell interactions. ATP1B2 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B2 protein, expressed by HEK293 , with N-His labeled tag. The total length of ATP1B2 Protein, Human (HEK293, His) is 223 a.a., with molecular weight of 40-60 kDa.

Background

The ATP1B2 protein functions as the non-catalytic component of the active enzyme responsible for catalyzing ATP hydrolysis coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. While the precise function of the beta-2 subunit remains elusive, it plays a crucial role in mediating cell adhesion for both neurons and astrocytes, contributing to the cohesive interaction between these cells. Additionally, ATP1B2 promotes neurite outgrowth, suggesting its involvement in the intricate processes that regulate the extension of neuronal projections. These cellular functions highlight ATP1B2's significance not only in ion transport but also in mediating adhesion and facilitating the structural development of neural networks.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

P14415 (D68-T290)

Gene ID

482  [NCBI]

Molecular Construction
N-term
His
ATP1B2 (D68-T290)
Accession # P14415
C-term
Synonyms
Sodium/potassium-transporting ATPase subunit beta-2; AMOG; ATP1B2
AA Sequence

DHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Molecular Weight

Approximately 40-60 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ATP1B2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATP1B2 Protein, Human (HEK293, His)
Cat. No.:
HY-P75587
Quantity:
MCE Japan Authorized Agent: