BGLAP Protein, Rat (GST)

BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization. The carboxylated form has a strong affinity for apatite and calcium. BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E. coli , with N-GST labeled tag. The total length of BGLAP Protein, Rat (GST) is 50 a.a., with molecular weight of ~32.6 kDa.

BGLAP protein, in its carboxylated form, plays a crucial role in the bone matrix by acting as a negative regulator of bone formation while maintaining bone resorption and mineralization. This form exhibits strong binding affinity to apatite and calcium. On the other hand, the uncarboxylated form functions as a hormone secreted by osteoblasts and regulates various cellular processes including energy metabolism, male fertility, and brain development. In terms of energy metabolism, it promotes pancreatic beta-cell proliferation, insulin secretion, insulin sensitivity, and energy expenditure. Additionally, the uncarboxylated osteocalcin hormone stimulates testosterone production in the testes by acting as a ligand for G protein-coupled receptor GPRC6A on Leydig cells, resulting in the activation of CREB-dependent pathways required for testosterone synthesis. Furthermore, this hormone serves as a regulator of brain development by crossing the blood-brain barrier and binding to GPR158 on neurons. This interaction prevents neuronal apoptosis in the hippocampus, promotes the synthesis of monoamine neurotransmitters, and inhibits the synthesis of gamma-aminobutyric acid (GABA). Notably, osteocalcin also crosses the placenta during pregnancy, and maternal osteocalcin is necessary for fetal brain development.

Rat

E. coli

N-GST

P04640 (Y50-V99)

25295  [NCBI]

YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

Approximately 32.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.