CD105/Endoglin Protein, Human (Trx-His)

CD105/Endoglin Protein, Human (Trx-His) is an accessory receptor for transforming growth factor beta (TGF-β), and is expressed on endothelial cells.

Endoglin (CD105) is an accessory receptor for transforming growth factor beta (TGF-β) and its expression is up-regulated in actively proliferating endothelial cells. Endoglin is co-expressed with β-glycan, another component of the TGF-βR complex, in the microvascular endothelium of normal tissue. Endoglin is an appropriate marker for tumor-related angiogenesis and neovascularization. The endothelial cells of neoplasms are more prolific than endothelial cells of normal tissue and thus they express elevated endoglin levels^[1].

Human

E. coli

N-Trx;N-6*His

P17813 (E26-Q176)

2022  [NCBI]

Trx-HHHHHHETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQ

Approximately 34 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Farshad Nassiri, et al. Endoglin (CD105): a review of its role in angiogenesis and tumor diagnosis, progression and therapy. Anticancer Res. 2011 Jun;31(6):2283-90.  [Content Brief]