CD200 Protein, Mouse (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD200 Protein, Mouse (HEK293, His) is 232 a.a., with molecular weight of ~24 kDa.

The CD200 protein plays a pivotal role in immune modulation, functioning as a costimulatory molecule that promotes T-cell proliferation. Additionally, CD200 is implicated in the potential regulation of myeloid cell activity across various tissues, as suggested by similarity-based inferences. The interaction between CD200 and its receptor, CD200R1, is facilitated through their respective N-terminal Ig-like domains. This interaction likely contributes to the regulatory processes involved in immune responses and myeloid cell function. The engagement of CD200 with CD200R1 underscores its significance in mediating immune cell communication and homeostasis, emphasizing its potential as a key player in immunomodulation.

Measured by its binding ability in a functional ELISA . Immobilized recombinant mouse CD200 at 1 μg/mL (100 μl/well) can bind mouse CD200R1/Fc with a linear range of 1.5-200 ng/mL.

Mouse

HEK293

C-His

O54901 (M1-G232)

17470  [NCBI]

MGSLVFRRPFCHLSTYSLIWGMAAVALSTAQVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG

Approximately 24 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.