CD43 Protein, Human (HEK293, His)

CD43 protein is an important leukocyte surface sialic acid protein that plays a key role in T cell regulation. It has a positive impact on T cell function, including activation, proliferation, differentiation, trafficking and migration, especially by helping T cells migrate to lymph nodes through ERM proteins. CD43 Protein, Human (HEK293, His) is the recombinant human-derived CD43 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD43 Protein, Human (HEK293, His) is 234 a.a., with molecular weight of 50-120 kDa.

The CD43 protein stands out as the predominant cell surface sialoprotein of leukocytes, orchestrating a myriad of crucial functions in T-cell regulation. It exerts a positive influence on T-cell activation, proliferation, differentiation, trafficking, and migration, notably facilitating T-cell trafficking to lymph nodes through its association with ERM proteins (EZR, RDX, and MSN). While playing a role in preparing T-cells for cytokine sensing and differentiation into effector cells, CD43 negatively regulates Th2 cell differentiation and steers T-cells toward a Th1 lineage commitment. Additionally, it plays a pivotal role in inducing the expression of IFN-gamma by T-cells during T-cell receptor (TCR) activation, promoting IFNGR and IL4R signaling, and mediating the clustering of IFNGR with TCR. Acting as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 serves as a T-cell counter-receptor for SIGLEC1, contributing to cell survival by protecting cells from apoptotic signals.

Human

HEK293

C-His

P16150 (S20-R253)

6693  [NCBI]

STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

50-120 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.