1. Recombinant Proteins
  2. Others
  3. CTACK/CCL27 Protein, Mouse

CTACK/CCL27 Protein, Mouse

Cat. No.: HY-P79264
COA Handling Instructions

CTACK/CCL27 protein plays a crucial role in chemokine activity and cell chemotaxis. It regulates T cell chemotaxis and actin cytoskeletal reorganization, suggesting its involvement in immune responses and cell motility. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free. The total length of CTACK/CCL27 Protein, Mouse is 95 a.a., with molecular weight of ~11 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $78 In-stock
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CTACK/CCL27 protein plays a crucial role in chemokine activity and cell chemotaxis. It regulates T cell chemotaxis and actin cytoskeletal reorganization, suggesting its involvement in immune responses and cell motility. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free. The total length of CTACK/CCL27 Protein, Mouse is 95 a.a., with molecular weight of ~11 kDa.

Background

CTACK/CCL27 protein serves a vital role by enabling chemokine activity and participating in cell chemotaxis. It acts upstream of positive regulation of T cell chemotaxis and positive regulation of actin cytoskeleton reorganization, suggesting its involvement in immune responses and cellular motility. This protein is located in the extracellular region and nucleus, highlighting its versatility in cellular processes. With a broad expression pattern across various tissues, including the genitourinary system, hip, liver, sensory organ, and skeleton, CTACK/CCL27 exhibits a widespread impact on different physiological contexts. The orthologous relationship with human CCL27 emphasizes the evolutionary conservation and functional relevance of this chemokine protein across species.

Biological Activity

Measured by its ability to chemoattract HUT78 cells. The ED50 for this effect is 0.0145 μg/mL, corresponding to a specific activity is 6.897×104 U/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

NP_035466 (L26-N120)

Gene ID

20301  [NCBI]

Molecular Construction
N-term
CCL27 (L26-N120)
Accession # NP_035466
C-term
Synonyms
C-C motif chemokine 27; CC chemokine ILC; IL-11 R-alpha-locus chemokine; cutaneous T-cell-attracting chemokine; skinkine; skinskine; small inducible cytokine A27a; ALP; ILC; CTAK; CTACK; Ccl27; PESKY; ESkine; Scya27; Scya27a; AW558992
AA Sequence

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN

Molecular Weight

Approximately 11 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 4mM HCL, pH 0.8, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CTACK/CCL27 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTACK/CCL27 Protein, Mouse
Cat. No.:
HY-P79264
Quantity:
MCE Japan Authorized Agent: