1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. Cyclophilin A Protein, Mouse (tag free)

Cyclophilin A Protein, Mouse (tag free)

Cat. No.: HY-P70007A
COA Handling Instructions

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse (tag free) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free. The total length of Cyclophilin A Protein, Mouse (tag free) is 164 a.a., with molecular weight of approximately 18.07 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $40 In-stock
50 μg $110 In-stock
100 μg $187 In-stock
500 μg $524 In-stock
1 mg $890 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Cyclophilin A Protein, Mouse (tag free)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse (tag free) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free. The total length of Cyclophilin A Protein, Mouse (tag free) is 164 a.a., with molecular weight of approximately 18.07 kDa.

Background

Cyclophilin A catalyzes the cis-trans isomerization of proline imidic peptide bonds, exerting a potent chemotactic effect on leukocytes through the activation of its membrane receptor BSG/CD147 and initiating a signaling cascade culminating in MAPK/ERK activation. This protein activates endothelial cells (ECs) in a pro-inflammatory manner by stimulating NF-kappa-B and MAP-kinase signaling, inducing the expression of adhesion molecules like SELE and VCAM1. Moreover, Cyclophilin A induces apoptosis in ECs by promoting FOXO1-dependent expression of CCL2 and BCL2L11. In response to oxidative stress, it initiates both proapoptotic and antiapoptotic signaling pathways in ECs through NF-kappa-B activation, AKT1 up-regulation, and BCL2 induction. It negatively regulates MAP3K5/ASK1 kinase activity and is essential for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein complexes, thereby influencing TARDBP binding to RNA and the expression of HDAC6, ATG7, and VCP, crucial for protein aggregate clearance. Cyclophilin A also plays a pivotal role in platelet activation and aggregation, regulates calcium mobilization, integrin ITGA2B:ITGB3 bidirectional signaling, and binds heparan sulfate glycosaminoglycans.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P17742 (M1-L164)

Gene ID

268373  [NCBI]

Molecular Construction
N-term
Cyclophilin A (M1-L164)
Accession # P17742
C-term
Synonyms
rMuPeptidyl-prolyl cis-trans isomerase A/Cyclophilin A; Peptidyl-prolyl cis-trans isomerase A; PPIase A; Cyclophilin A; Cyclosporin A-binding protein; Rotamase A; SP18; PPIA; CYPA
AA Sequence

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Weight

approximately 18.07 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cyclophilin A Protein, Mouse (tag free) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cyclophilin A Protein, Mouse (tag free)
Cat. No.:
HY-P70007A
Quantity:
MCE Japan Authorized Agent: