2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His)

Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His)

Cat. No.: HY-P75781
COA Handling Instructions

The Follistatin-like 1/FSTL1 protein binds calcium ions and heparin. It is involved in endothelial cell differentiation, migration, and BMP signaling regulation. FSTL1 also contributes to hematopoietic stem cell homeostasis. It is located in the extracellular region and is expressed in tissues like the heart and lung. The Alliance of Genome Resources supports its function. Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His) is the recombinant rat-derived Follistatin-like 1/FSTL1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His) is 288 a.a., with molecular weight of ~34 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $63 In-stock
10 μg $107 In-stock
50 μg $300 In-stock
100 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Follistatin-like 1/FSTL1 protein binds calcium ions and heparin. It is involved in endothelial cell differentiation, migration, and BMP signaling regulation. FSTL1 also contributes to hematopoietic stem cell homeostasis. It is located in the extracellular region and is expressed in tissues like the heart and lung. The Alliance of Genome Resources supports its function. Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His) is the recombinant rat-derived Follistatin-like 1/FSTL1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His) is 288 a.a., with molecular weight of ~34 kDa.
Background

The Follistatin-like 1 (FSTL1) protein is predicted to have calcium ion binding and heparin binding activity. It is also predicted to be involved in processes such as endothelial cell differentiation, endothelial cell migration, and regulation of the BMP signaling pathway. Additionally, it is predicted to play a role in hematopoietic stem cell homeostasis and is located in the extracellular region. The FSTL1 protein is orthologous to the human FSTL1 gene and its function is supported by the Alliance of Genome Resources. It shows biased expression in tissues such as the heart, lung, and nine other tissues.
Species

Rat
Source

HEK293
Tag

C-10*His
Accession

NP_077345.1 (E19-I306)
Gene ID

79210  [NCBI]
Molecular Construction
N-term
FSTL1 (E19-I306)
Accession # NP_077345.1
10*His
C-term
Synonyms
Follistatin-related protein 1; Follistatin-like protein 1; FSTL1; FRP
AA Sequence

EEEQRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDELRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAVNITAYPNQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTEEEMTRYAQELQKHQGTAEKTKKVNTKEI

Molecular Weight

Approximately 34 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Solution.
Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

N/A.
Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping

Shipping with dry ice.
Documentation

COA (220 KB)

Handling Instructions (2659 KB)

Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Follistatin-like 1/FSTL1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P75781
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.