GJA1 Protein, Human (His)

The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GJA1 Protein, Human (His) is 150 a.a., with molecular weight of ~22 kDa.

The GJA1 Protein serves as a gap junction protein with regulatory roles in bladder capacity. Comprising closely packed pairs of transmembrane channels called connexons, it facilitates the diffusion of low molecular weight materials between neighboring cells. This protein plays a crucial role in hearing physiology by participating in the recycling of potassium to the cochlear endolymph. Acting as a negative regulator of bladder functional capacity, GJA1 enhances intercellular electrical and chemical transmission, sensitizing bladder muscles to cholinergic neural stimuli and causing contraction. Additionally, it may contribute to cell growth inhibition through the regulation of NOV expression and localization. Essential for gap junction communication in the ventricles, GJA1 interacts with various proteins, including TJP1, SRC, UBQLN4, SGSM3, CNST, RIC1/CIP150, CSNK1D, NOV, and TMEM65, thereby playing a multifaceted role in cellular communication and regulation.

Human

E. coli

N-6*His

P17302 (F233-I382)

2697  [NCBI]

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Approximately 22 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.