IDUA Protein, Human (His)

IDUA Protein, with catalytic activity, hydrolyzes unsulfated alpha-L-iduronosidic linkages in dermatan sulfate. Its enzymatic function is crucial in breaking down these specific bonds, contributing to the degradation of dermatan sulfate and maintaining cellular homeostasis. IDUA Protein, Human (His) is the recombinant human-derived IDUA protein, expressed by E. coli , with N-6*His labeled tag. The total length of IDUA Protein, Human (His) is 626 a.a., with molecular weight of ~73.9 kDa.

IDUA Protein exhibits catalytic activity, specifically engaging in the hydrolysis of unsulfated alpha-L-iduronosidic linkages within dermatan sulfate. Through its enzymatic function, IDUA plays a crucial role in breaking down these specific chemical bonds, contributing to the degradation of dermatan sulfate and maintaining cellular homeostasis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P35475 (A28-P653)

3425  [NCBI]

APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

Approximately 73.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of Tris-based buffer, 50% Glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.