1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 2a
  6. IFN-alpha 2a/IFNA2 Protein, Human (R46K)

IFN-alpha 2a/IFNA2 Protein, Human (R46K)

Cat. No.: HY-P7022
COA Handling Instructions

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection. IFN-alpha 2 exerts cytotoxic activity against CD8+ T cells and induces CD4+ T cell depletion. IFN-alpha 2a/IFNA2 Protein, Human (C24-E188, R46K) contains 165 a.a., is produced in E. coli with tag free.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $60 In-stock
50 μg $120 In-stock
100 μg $175 In-stock
500 μg $350 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection[1]. IFN-alpha 2 exerts cytotoxic activity against CD8+ T cells and induces CD4+ T cell depletion[3]. IFN-alpha 2a/IFNA2 Protein, Human (C24-E188, R46K) contains 165 a.a., is produced in E. coli with tag free.

Background

IFN-alpha 2 (IFNA2; IFN-α2), belongs to the type I interferon family, produced by the plasmacytoid dendritic cells (pDCs) exposure to HIV-1BaL in order to inhibit viral infection[1].
Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
IFN-alpha 2 subtype is the only one that is currently licensed to treat infections caused by hepatitis B virus (HBV) and HCV[3].
IFN-alpha 2 shows a Sortilin-dependent trafficking in cells and increases the expression level of interferon-stimulated genes (ISGs) in HIV-infected cells[1][4]. It also exhibits cytotoxic activity against CD8+ T cells and enhances CD4+ T cell depletion[3].
Among the IFN-alpha 2 alleles, IFN-alpha 2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant[5].
IFN-alpha 2 has a bored application in research of cancer, including some hematological malignancies and solid tumors[6]. As for a wildly use of IFN in animal disease model, the sequence of amino acids in IFNA2a protein of human is very different from mouse (59.57%).

In Vivo

IFNA2a (hydrodynamic injection with plasmids) leads to upregulation of interferon-stimulated genes (ISGs) and results HIV-1 induced CD4+ T cell depletion in the hu-PBL humanized mouse model[3].

Biological Activity

The ED50 is ≤0.5005 ng/mL as measured by TF-1 cells, corresponding to a specific activity of ≥1.998 × 106 units/mg.

  • Measured by a cytotoxicity assay using TF-1 Cells. The ED50  for this effect is 0.1509 ng/mL, corresponding to a specific activity is 6.627 ×106units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01563 (C24-E188, R46K)

Gene ID
Molecular Construction
N-term
IFNA2 (C24-E188, R46K)
Accession # P01563
C-term
Synonyms
rHuIFN-α2a; IFNA; IFNA2; IFN-a 2a
AA Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Molecular Weight

Approximately 16-20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.2 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-alpha 2a/IFNA2 Protein, Human (R46K) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 2a/IFNA2 Protein, Human (R46K)
Cat. No.:
HY-P7022
Quantity:
MCE Japan Authorized Agent: