1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-10
  5. IL-10 Protein, Human

IL-10 Protein, Human

Cat. No.: HY-P7030
COA Handling Instructions

IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
5 μg $100 In-stock
20 μg $300 In-stock
100 μg $820 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Background

Interleukin 10 (IL-10) is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation. A promising alternative is interleukin 10 (IL-10), a cytokine with multiple anti-inflammatory and immunoregulatory activities, including inhibition of T-cell/macrophage activation and proinflammatory cytokine synthesis[1]. IL-10, a cytokine possessing strong anti-inflammatory properties, is under investigation for its therapeutic use as an immunosuppressant. The immunosuppressive actions of IL-10 and corticosteroids include inhibition of proinflammatory cytokine production by monocytes and polymorphonuclear leukocytes (IFN-γ, TNF-α, IL-1β, IL-6, GM-CSF) both at the protein and messenger RNA levels and prevention of mitogen-induced T-cell proliferation[2].

Biological Activity

1.The ED50 is typically 1- 8 ng/mL as measured by MC/9-2 mouse mast cells in a cell proliferation assay.
2.Immobilized human IL10 at 10 μg/mL (100 μL/well) can bind Cynomolgus IL10RA-Fc and the EC50 of Cynomolgus IL10RA-Fc is 0.24-0.56 μg/mL.
3.Immobilized human IL10 at 2 μg/mL (100 μL/well) can bind Cynomolgus IL10RA-Fc and the EC50 of Cynomolgus IL10RA-Fc is 0.1-0.3 μg/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P22301 (S19-N178)

Gene ID
Molecular Construction
N-term
IL-10 (S19-N178)
Accession # P22301
C-term
Synonyms
rHuIL-10; CSIF
AA Sequence

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Weight

Approximately 18.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 20mM Tris, 20mM NaCl, pH 6.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-10 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-10 Protein, Human
Cat. No.:
HY-P7030
Quantity:
MCE Japan Authorized Agent: