IL-3 Protein, Rhesus macaque (His)

IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IL-3 Protein, Rhesus macaque (His) is 124 a.a., with molecular weight of approximately 17 kDa.

IL-3, a hematopoietic cytokine, exerts regulatory control over hematopoiesis by influencing the production, differentiation, and function of distinct white blood cell populations, including granulocytes, monocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils, and megakaryocytes. Acting as a colony-stimulating factor, IL-3 plays a crucial role in promoting the development and maturation of these various cell types within the blood, contributing to the maintenance of a functional and balanced immune system.

Measured in a cell proliferation assay using using TF1 human human erythroleukemic cells.The ED₅₀ for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using TF1 human erythroleukemic cells.The ED₅₀ for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×10⁶ units/mg.

Rhesus Macaque

E. coli

N-6*His

P25140 (A20-Q143)

706946  [NCBI]

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.