MAP3K1 Protein, Mouse (His)

MAP3K1 is a key component of the protein kinase signal transduction cascade and plays a crucial role in cell signaling pathways. Through its kinase activity, MAP3K1 coordinates the activation of the ERK and JNK kinase pathways by phosphorylating MAP2K1 and MAP2K4. MAP3K1 Protein, Mouse (His) is the recombinant mouse-derived MAP3K1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of MAP3K1 Protein, Mouse (His) is 278 a.a., with molecular weight of 34.8 kDa.

MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) is a critical component of a protein kinase signal transduction cascade, playing a key role in cellular signaling. It functions by activating the ERK and JNK kinase pathways through the phosphorylation of MAP2K1 and MAP2K4. Additionally, MAP3K1 may phosphorylate the MAPK8/JNK1 kinase, further contributing to the regulation of cellular responses. Moreover, MAP3K1 has the ability to activate CHUK and IKBKB, central protein kinases in the NF-kappa-B pathway, suggesting its involvement in the modulation of immune and inflammatory responses. The multifaceted actions of MAP3K1 highlight its importance in orchestrating complex signaling networks, making it a crucial regulator of various cellular processes. (

Mouse

E. coli

N-6*His

P53349 (Q1216-W1493)

26401  [NCBI]

QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW

34.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.