1. Recombinant Proteins
  2. Others
  3. MESDC2 Protein, Human (HEK293, His)

MESDC2 Protein, Human (HEK293, His)

Cat. No.: HY-P76492
COA Handling Instructions

The MESDC2 protein acts as a chaperone and plays a specific role in promoting the folding of the β-propeller/EGF module within the low-density lipoprotein receptor (LDLR) family. In addition to participating in LDLR folding, MESDC2 acts as an important regulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, thereby affecting Wnt signaling. MESDC2 Protein, Human (HEK293, His) is the recombinant human-derived MESDC2 protein, expressed by HEK293 , with C-His labeled tag. The total length of MESDC2 Protein, Human (HEK293, His) is 197 a.a., with molecular weight of ~27 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $65 In-stock
50 μg $175 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MESDC2 protein acts as a chaperone and plays a specific role in promoting the folding of the β-propeller/EGF module within the low-density lipoprotein receptor (LDLR) family. In addition to participating in LDLR folding, MESDC2 acts as an important regulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, thereby affecting Wnt signaling. MESDC2 Protein, Human (HEK293, His) is the recombinant human-derived MESDC2 protein, expressed by HEK293 , with C-His labeled tag. The total length of MESDC2 Protein, Human (HEK293, His) is 197 a.a., with molecular weight of ~27 KDa.

Background

MESDC2 protein serves as a chaperone with specific roles in facilitating the folding of beta-propeller/EGF modules within the low-density lipoprotein receptor (LDLR) family. Beyond its involvement in LDLR folding, MESDC2 acts as a crucial modulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, influencing Wnt signaling (PubMed:17488095). In embryonic development, MESDC2 plays an essential role in specifying polarity and inducing mesoderm formation. Additionally, it contributes significantly to neuromuscular junction (NMJ) formation by promoting the cell-surface expression of LRP4 (By similarity). The protein may also regulate the phagocytosis of apoptotic retinal pigment epithelium (RPE) cells (By similarity). As a monomer, MESDC2 interacts with LRP5 and LRP6, preventing their aggregation and guiding them to the plasma membrane. Furthermore, MESDC2 interacts with LRP4, promoting glycosylation and cell-surface expression of LRP4 (By similarity).

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q14696-1 (A34-K230)

Gene ID
Molecular Construction
N-term
MESDC2 (A34-K230)
Accession # Q14696
His
C-term
Synonyms
LRP chaperone MESD; LDLR chaperone MESD; KIAA0081; MESDM
AA Sequence

AEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNK

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MESDC2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MESDC2 Protein, Human (HEK293, His)
Cat. No.:
HY-P76492
Quantity:
MCE Japan Authorized Agent: