NKp30/NCR3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

NKp30/NCR3 protein is a cell membrane receptor on natural killer (NK) cells that activates cytotoxicity by binding to ligands such as BAG6 and NCR3LG1, stimulating NK cells to respond against neighboring cells (including tumor cells) expressing these ligands. NKp30/NCR3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived NKp30/NCR3 protein, expressed by HEK293 , with C-His labeled tag. The total length of NKp30/NCR3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is 117 a.a., with molecular weight of ~23-32 kDa.

NKp30/NCR3 protein, serving as a cell membrane receptor on natural killer (NK) cells, becomes activated upon binding extracellular ligands such as BAG6 and NCR3LG1. Upon ligand binding, NKp30/NCR3 stimulates NK cell cytotoxicity against neighboring cells expressing these ligands, thereby exerting control over NK cell cytotoxicity against tumor cells. The engagement of NCR3 by BAG6 not only enhances NK cell-mediated killing of myeloid dendritic cells (DCs) that failed to acquire a mature phenotype but also promotes DC maturation. This occurs through the release of TNFA and IFNG by NK cells, further contributing to the maturation process. In its unliganded form, NKp30/NCR3 forms homodimers and interacts with CD3Z, as well as with and is activated by binding to both NCR3LG1 and BAG6, unraveling its intricate roles in regulating immune responses, NK cell cytotoxicity, and DC maturation.

Measured by its binding ability in a functional ELISA. When Recombinant Human B7-H6 is immobilized at 0.5 µg/mL (100 µL/well) can bind Recombinant Cynomolgus NKp30/NCR3. The ED₅₀ for this effect is 59.89 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human B7-H6 is immobilized at 0.5 µg/mL (100 µL/well) can bind Recombinant Cynomolgus NKp30/NCR3. The ED₅₀ for this effect is 59.89 ng/mL.

Rhesus Macaque

HEK293

C-His

XP_005553604 (L19-G135)

102133932  [NCBI]

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLG

The protein migrates as an approximately 23-32 kDa band under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.