PGLYRP1/PGRP-S Protein, Mouse (HEK293, His)

PGLYRP1/PGRP-S Protein plays a vital role in the innate immune response. It recognizes bacterial peptidoglycan and activates antimicrobial defense mechanisms. PGLYRP1/PGRP-S Protein interacts with other immune molecules, enhancing immune responses against bacterial infections. Understanding its functions can aid in developing strategies to combat bacterial pathogens. PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGLYRP1/PGRP-S protein, expressed by HEK293 , with C-His labeled tag. The total length of PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) is 164 a.a., with molecular weight of 18-21 kDa.

PGLYRP1/PGRP-S, an innate immunity protein, serves multifaceted roles in antimicrobial and antitumor defense systems. Functioning as a pattern receptor, it binds to murein peptidoglycans (PGN) from Gram-positive bacteria, thereby exerting bactericidal activity. Additionally, it forms an equimolar complex with heat shock protein HSPA1A, triggering programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor. Collaborating with the Ca(2+)-binding protein S100A4, it acts as a chemoattractant that induces lymphocyte movement and activates lymphocytes to eliminate virus-infected and tumor cells. The induction of cytotoxicity on monocyte surfaces requires interaction with the TREM1 receptor. This protein exhibits a homodimeric structure linked by disulfide bonds and interacts intricately with HSPA1A and HSPBP1, modulating its cytotoxic activity. These versatile functions underscore the critical involvement of PGLYRP1/PGRP-S in immune response and defense mechanisms.

Mouse

HEK293

C-His

O88593 (F19-E182)

21946  [NCBI]

FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE

Approximately 18 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.