PILR-alpha Protein, Human (178a.a, HEK293, His)

Paired immunoglobulin-like type 2 receptor alpha (PILRA) is a immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing member of the paired receptor which consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction such as SH1 through dephosphorylation of signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, His) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-His labeled tag. The total length of PILR-alpha Protein, Human (178a.a, HEK293, His) is 178 a.a., with molecular weight of ~24.9 KDa.

Paired immunoglobulin-like type 2 receptor alpha (PILRA) is a immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing member of the paired receptor which consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases like PTPN6/SHP-1 and PTPN11/SHP-2 via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules, while SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. PLPRA is a receptor for PIANP and also acts as an entry co-receptor for herpes simplex virus 1^[1][2][3].

Immobilized Human PILRA, His Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-PILRA Antibody, Rabbit IgG Tag with the EC₅₀ of ≤8.9 ng/mL determined by ELISA.

Human

HEK293

C-His

Q9UKJ1 (Q20-A197)

29992  [NCBI]

QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETA

40-50 kDa.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.