1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Plasma kallikrein/KLKB1 Protein, Human (HEK293, His)

Plasma kallikrein/KLKB1 Protein, Human (HEK293, His)

Cat. No.: HY-P70249A
COA Handling Instructions

Plasma kallikrein (KLKB1) serves as an enzyme, cleaving Lys-Arg and Arg-Ser bonds to release bradykinin from HMW kininogen. It plays a crucial role in the reciprocal activation of factor XII, especially upon binding to a negatively charged surface. Besides its role in the kinin system, KLKB1 may contribute to the renin-angiotensin system by converting prorenin into renin. Plasma kallikrein/KLKB1 Protein, Human (HEK293, His) is the recombinant human-derived Plasma kallikrein/KLKB1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Plasma kallikrein/KLKB1 Protein, Human (HEK293, His) is 619 a.a., with molecular weight of 72-80 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $235 In-stock
50 μg $520 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Plasma kallikrein (KLKB1) serves as an enzyme, cleaving Lys-Arg and Arg-Ser bonds to release bradykinin from HMW kininogen. It plays a crucial role in the reciprocal activation of factor XII, especially upon binding to a negatively charged surface. Besides its role in the kinin system, KLKB1 may contribute to the renin-angiotensin system by converting prorenin into renin. Plasma kallikrein/KLKB1 Protein, Human (HEK293, His) is the recombinant human-derived Plasma kallikrein/KLKB1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Plasma kallikrein/KLKB1 Protein, Human (HEK293, His) is 619 a.a., with molecular weight of 72-80 kDa.

Background

Plasma kallikrein (KLKB1) is an enzyme with the ability to cleave Lys-Arg and Arg-Ser bonds, facilitating the release of bradykinin from HMW kininogen. Additionally, KLKB1 plays a pivotal role in the activation of factor XII through a reciprocal reaction, particularly following its binding to a negatively charged surface. Beyond its involvement in the kinin system, this enzyme may contribute to the renin-angiotensin system by converting prorenin into renin.

Biological Activity

Immobilized Human KLKB1, His Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-KLKB1 Antibody, hFc Tag with the EC50 of ≤33.8 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-His

Accession

P03952 (G20-A638)

Gene ID

3818

Molecular Construction
N-term
KLKB1 (G20-A638)
Accession # P03952
His
C-term
Synonyms
Plasma kallikrein; PKK; KLK3; KLKB1; Fletcher factor; Kininogenin
AA Sequence

GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA

Molecular Weight

72-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in 20 mM NaAc,150 mM NaCl, pH 5.0. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 20 mM NaAc,150 mM NaCl, pH 5.0.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Plasma kallikrein/KLKB1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Plasma kallikrein/KLKB1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70249A
Quantity:
MCE Japan Authorized Agent: