1. Recombinant Proteins
  2. Others
  3. PLXNA1 Protein, Human (His)

PLXNA1 Protein, Human (His)

Cat. No.: HY-P71646
Handling Instructions

PLXNA1 protein serves as a co-receptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D, achieving cytoskeletal remodeling and signaling through three types of signaling proteins. PLXNA1 Protein, Human (His) is the recombinant human-derived PLXNA1 protein, expressed by E. coli , with N-His labeled tag. The total length of PLXNA1 Protein, Human (His) is 167 a.a., with molecular weight of ~22.3 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PLXNA1 protein serves as a co-receptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D, achieving cytoskeletal remodeling and signaling through three types of signaling proteins. PLXNA1 Protein, Human (His) is the recombinant human-derived PLXNA1 protein, expressed by E. coli , with N-His labeled tag. The total length of PLXNA1 Protein, Human (His) is 167 a.a., with molecular weight of ~22.3 kDa.

Background

PLXNA1 protein serves as a coreceptor for SEMA3A, SEMA3C, SEMA3F, and SEMA6D, playing an essential role in signaling by class 3 semaphorins and subsequent cytoskeleton remodeling. It is integral to processes such as axon guidance, invasive growth, and cell migration. In the presence of class 3 semaphorins, PLXNA1 forms a complex with a neuropilin, and this interaction modulates the affinity of the complex for specific semaphorins. The cytoplasmic domain of PLXNA1 is crucial for activating downstream signaling events within the cytoplasm. Notably, the protein interacts directly with neuropilins NRP1 and NRP2, and it also engages with FARP2, RND1, and KDR/VEGFR2. The binding of SEMA3A to PLXNA1 leads to the dissociation of FARP2, highlighting the intricate regulatory role of PLXNA1 in semaphorin-mediated cellular responses.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9UIW2 (986L-1152L)

Gene ID
Molecular Construction
N-term
His
PLXNA1 (986L-1152L)
Accession # Q9UIW2
C-term
Synonyms
PLXNA1; NOV; PLXN1; Plexin-A1; Semaphorin receptor NOV
AA Sequence

LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL

Molecular Weight

Approximately 22.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PLXNA1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLXNA1 Protein, Human (His)
Cat. No.:
HY-P71646
Quantity:
MCE Japan Authorized Agent: