1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. TEV Protease Protein, Tobacco etch virus (S2256N, C-His)

TEV Protease Protein, Tobacco etch virus (S2256N, C-His)

Cat. No.: HY-P79151A
COA Handling Instructions

The TEV protease is critical in aphid transmission and has proteolytic activity that cleaves the Gly-Gly dipeptide at its C terminus. In addition to proteolysis, it interacts with virions and aphid stylets, which is critical for aphid transmission. TEV Protease Protein, Tobacco etch virus (S2256N, C-His) is the recombinant Virus-derived TEV Protease protein, expressed by E. coli , with C-6*His labeled tag. The total length of TEV Protease Protein, Tobacco etch virus (S2256N, C-His) is 241 a.a., with molecular weight of approximately 34 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $50 Get quote
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TEV protease is critical in aphid transmission and has proteolytic activity that cleaves the Gly-Gly dipeptide at its C terminus. In addition to proteolysis, it interacts with virions and aphid stylets, which is critical for aphid transmission. TEV Protease Protein, Tobacco etch virus (S2256N, C-His) is the recombinant Virus-derived TEV Protease protein, expressed by E. coli , with C-6*His labeled tag. The total length of TEV Protease Protein, Tobacco etch virus (S2256N, C-His) is 241 a.a., with molecular weight of approximately 34 kDa.

Background

TEV Protease plays a crucial role in aphid transmission and exhibits proteolytic activity, specifically cleaving a Gly-Gly dipeptide at its own C-terminus. Beyond its proteolytic function, TEV Protease interacts with virions and aphid stylets, contributing to its significance in the aphid transmission process. Additionally, TEV Protease acts as a suppressor of RNA-mediated gene silencing, a plant viral defense mechanism, thus modulating the accumulation of viral RNAs. Its potential RNA-binding activity and helicase function suggest its involvement in replication processes. The multifaceted roles of TEV Protease underscore its importance in various aspects of viral infection and host-pathogen interactions.

Biological Activity

Measured by its ability to cleave a fusion protein containing the recognition sequence Glu-Asn-Leu-Tyr-Phe-Gln, with the cleavage point after Gln. TEV Protease cleaves ≥50% of the control substrate.

Species

Virus

Source

E. coli

Tag

C-6*His

Accession

NP_062908 (E2039-Q2279)

Gene ID

1502321  [NCBI]

Molecular Construction
N-term
TEV Protease (E2039-Q2279)
Accession # NP_062908
6*His
C-term
Synonyms
Genome polyprotein; Tobacco Etch Virus Protease
AA Sequence

ESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMNKPEEPFQPVKEATQLMNELVYSQ

Molecular Weight

approximately 34 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TEV Protease Protein, Tobacco etch virus (S2256N, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TEV Protease Protein, Tobacco etch virus (S2256N, C-His)
Cat. No.:
HY-P79151A
Quantity:
MCE Japan Authorized Agent: