1. Recombinant Proteins
  2. Viral Proteins
  3. HPV Proteins
  4. HPV E7 Proteins
  5. Protein E7, HPV (His)

Protein E7, HPV (His)

Cat. No.: HY-P72259
COA Handling Instructions

HPV protein E7 can induce dormant cells to enter the cell cycle and promote the efficient use of cellular DNA replication mechanisms for viral genome replication. Through translational and transactivation activities, E7 disrupts the RB1-E2F1 complex and activates E2F1-regulated S-phase genes. Protein E7, HPV (His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli , with N-6*His labeled tag. The total length of Protein E7, HPV (His) is 98 a.a., with molecular weight of ~21 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $65 In-stock
10 μg $100 In-stock
50 μg $282 In-stock
100 μg $480 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HPV protein E7 can induce dormant cells to enter the cell cycle and promote the efficient use of cellular DNA replication mechanisms for viral genome replication. Through translational and transactivation activities, E7 disrupts the RB1-E2F1 complex and activates E2F1-regulated S-phase genes. Protein E7, HPV (His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli , with N-6*His labeled tag. The total length of Protein E7, HPV (His) is 98 a.a., with molecular weight of ~21 kDa.

Background

The Protein E7 from Human Papillomavirus (HPV) plays a crucial role in viral genome replication by inducing quiescent cells to enter the cell cycle, facilitating the efficient utilization of the cellular DNA replicating machinery for viral genome replication. E7 exhibits both transforming and trans-activating activities, disrupting the RB1-E2F1 complex and activating E2F1-regulated S-phase genes. It interferes with host histone deacetylation mediated by HDAC1 and HDAC2, resulting in transcriptional activation. Additionally, E7 inhibits the antiviral and antiproliferative functions of host interferon alpha. Its interaction with host TMEM173/STING hinders the ability of TMEM173/STING to sense cytosolic DNA and promote type I interferon production. E7 forms homodimers and homooligomers, interacts with host RB1 to disrupt RB1 activity, and associates with EP300 to repress EP300 transcriptional activity. Complex formation with CHD4 and HDAC1 alters host histone deacetylation, while the interaction with protein E2 inhibits E7 oncogenic activity. The multifaceted actions of Protein E7 underscore its pivotal role in HPV-associated cellular processes and its intricate modulation of host cell functions.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED50 for this effect is ≤0.3071 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED50 for this effect is 0.2398 μg/mL, corresponding to a specific activity is 4.17×103 Unit/mg.
Species

Virus

Source

E. coli

Tag

N-6*His

Accession

P03129 (M1-P98)

Gene ID

1489079  [NCBI]

Molecular Construction
N-term
6*His
Protein E7 (M1-P98)
Accession # P03129
C-term
Synonyms
E7; Protein E7
AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Molecular Weight

Approximately 19-21 kDa

Purity
  • Greater than 94% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from 0.2 μm filtered solution in 20 mM Tris-HCL, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or PBS, 6% Trehalose, pH 7.4 or 50 mM Tris-HCL, 200 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Protein E7, HPV (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protein E7, HPV (His)
Cat. No.:
HY-P72259
Quantity:
MCE Japan Authorized Agent: