RCN1 Protein, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag. The total length of RCN1 Protein, Human (P.pastoris, His) is 301 a.a., with molecular weight of ~44 kDa.

RCN1 Protein emerges as a potential regulator, suggesting its role in modulating calcium-dependent activities within the endoplasmic reticulum (ER) lumen or the post-ER compartment. The specific mechanisms through which RCN1 exerts its regulatory influence on calcium-dependent processes remain to be fully elucidated, prompting further investigation into its functional significance in these cellular compartments. The proposed role of RCN1 in calcium regulation hints at its potential involvement in diverse cellular activities associated with calcium signaling and homeostasis. Comprehensive studies are essential to unravel the precise molecular pathways through which RCN1 modulates calcium-dependent activities and to understand its broader implications in cellular processes.

Human

P. pastoris

N-His

Q15293 (31P-331L)

5954  [NCBI]

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Approximately 44 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.