SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His)

SCG3, a granin protein, regulates secretory granule formation and acts as a sorting receptor for intragranular proteins like CHGA. It interacts with SCG2 and CHGA, coordinating cellular processes. SCG3 also interacts with CPE, implying involvement in diverse cellular functions and regulatory pathways. Moreover, it may facilitate angiogenesis by promoting endothelial cell proliferation, migration, and tube formation via the MEK/ERK pathway. SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His) is the recombinant human-derived SCG3/Secretogranin-3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His) is 449 a.a., with molecular weight of ~63.84 kDa.

Secretogranin-3 (SCG3), a member of the granin protein family, actively regulates the biogenesis of secretory granules, acting as a sorting receptor for intragranular proteins, including chromogranin A (CHGA). Beyond its role in granule formation, SCG3 may participate in angiogenesis, exerting effects on endothelial cells by promoting proliferation, migration, and tube formation through the MEK/ERK signaling pathway. The protein interacts with CHGA and secretogranin II (SCG2), contributing to the orchestration of cellular processes. Additionally, SCG3 forms interactions, specifically through its C-terminus, with Carboxypeptidase E (CPE), suggesting a potential involvement in various cellular functions and regulatory pathways.

Data is not available.

Human

HEK293

C-6*His

Q8WXD2 (F20-L468)

29106  [NCBI]

FPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

Approximately 63.84 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.