2. Recombinant Proteins
  3. Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His)

Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His)

Cat. No.: HY-P70142A
Handling Instructions

Spondin-2/SPON2 protein, as a cell adhesion molecule, plays a key role in promoting the adhesion and growth of hippocampal embryonic neurons. In addition to its role in neurodevelopment, SPON2 acts as a direct binder of bacteria and their components, functioning as an opsonin to promote phagocytosis of bacteria by macrophages. Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with His labeled tag. The total length of Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) is 305 a.a., with molecular weight of 38-42 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Spondin-2/SPON2 protein, as a cell adhesion molecule, plays a key role in promoting the adhesion and growth of hippocampal embryonic neurons. In addition to its role in neurodevelopment, SPON2 acts as a direct binder of bacteria and their components, functioning as an opsonin to promote phagocytosis of bacteria by macrophages. Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with His labeled tag. The total length of Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) is 305 a.a., with molecular weight of 38-42 kDa.
Background

Spondin-2, also known as SPON2, is a versatile cell adhesion protein crucial for hippocampal embryonic neuron adhesion and outgrowth. Its functional diversity extends to binding bacteria and their components, serving as an opsonin that facilitates macrophage phagocytosis of bacteria. Essential in initiating the innate immune response, SPON2 acts as a unique pattern-recognition molecule in the extracellular matrix (ECM) for microbial pathogens, specifically binding bacterial lipopolysaccharide (LPS). Existing as a monomer, SPON2 interacts with integrins, further emphasizing its role in mediating cell-matrix interactions (
Species

Human
Source

HEK293
Tag

His
Accession

Q9BUD6 (Q27-V331)
Gene ID

10417
Molecular Construction
N-term
SPON2 (Q27-V331)
Accession # Q9BUD6
10*His
C-term
Synonyms
rHuSpondin-2/SPON2, His; Spondin-2; Differentially expressed in cancerous and non-cancerous lung cells 1; DIL-1; Mindin; SPON2
AA Sequence

QPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV

Molecular Weight

38-42 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His)
Cat. No.:
HY-P70142A
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.