1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TNF-β
  6. TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi)

TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P700612
Handling Instructions

TNF-β protein acts as a homotrimeric cytokine that binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM. TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived TNF-beta/TNFSF1 protein, expressed by HEK293 , with N-Avi, N-6*His labeled tag. The total length of TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi) is 171 a.a., with molecular weight of 22.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNF-β protein acts as a homotrimeric cytokine that binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM. TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived TNF-beta/TNFSF1 protein, expressed by HEK293 , with N-Avi, N-6*His labeled tag. The total length of TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi) is 171 a.a., with molecular weight of 22.7 kDa.

Background

TNF-beta Protein, in its homotrimeric configuration, exhibits binding capabilities to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM, as demonstrated by various studies. Additionally, in its heterotrimeric association with LTB, it forms interactions with TNFRSF3/LTBR, underscoring its diverse receptor engagement. This cytokine, primarily produced by lymphocytes, showcases cytotoxic effects against a broad array of tumor cells both in vitro and in vivo. Structurally, TNF-beta exists as both homotrimers and heterotrimers, the latter comprising either two LTB and one LTA subunits or, to a lesser extent, two LTA and one LTB subunits. Furthermore, TNF-beta engages in interactions with TNFRSF14, emphasizing its pivotal role in mediating intricate immunological responses.

Species

Human

Source

HEK293

Tag

N-Avi;N-6*His

Accession

P01374 (L35-L205)

Gene ID
Molecular Construction
N-term
6*His-Avi
TNF-β (L35-L205)
Accession # P01374
C-term
Synonyms
LTA; lymphotoxin alpha (TNF superfamily, member 1); LT; TNFB; TNFSF1; lymphotoxin alpha; OTTHUMP00000165897; tumor necrosis factor beta; Tumor necrosis factor ligand superfamily member 1; TNF-beta; LT-alpha
AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Molecular Weight

22.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P700612
Quantity:
MCE Japan Authorized Agent: