TPPP3 Protein, Human (His)

TPPP3 Protein, a microtubule-associated regulator, crucially influences microtubule dynamics through bundling activity. Its essential role extends to embryo implantation and decidualization, implicating reproductive events. The impact on implantation suggests a regulatory function linked to beta-catenin, a key signaling molecule. TPPP3's involvement in decidualization emphasizes its significance in cellular events, particularly through beta-catenin signaling, making TPPP3 a versatile player in cellular dynamics with implications for development and reproduction. TPPP3 Protein, Human (His) is the recombinant human-derived TPPP3 protein, expressed by E. coli, with N-His labeled tag. The total length of TPPP3 Protein, Human (His) is 176 a.a., with molecular weight of ~21 kDa.

TPPP3, a microtubule-associated protein, assumes a pivotal role as a regulator of microtubule dynamics, exerting its influence through microtubule bundling activity. Its essential involvement extends to critical biological processes, notably embryo implantation and decidualization, suggesting a role in reproductive events. The impact on embryo implantation implies a potential regulatory function linked to beta-catenin, a key signaling molecule in cellular processes. Moreover, TPPP3's role in decidualization reinforces its significance in orchestrating cellular events, particularly through its influence on beta-catenin signaling. These findings underscore TPPP3 as a versatile player in cellular dynamics, with implications for fundamental processes in development and reproduction.

Human

E. coli

N-His

Q9BW30 (M1-K176)

51673  [NCBI]

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

Approximately 19 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.