UbcH5b/UBE2D2 Protein, Human

The UbcH5b/UBE2D2 protein is an important cellular mediator that accepts ubiquitin from the E1 complex and catalyzes multifunctional “Lys-48”-linked polyubiquitination on target proteins. In addition to its catalytic role, it also concentrates and selectively degrades short-lived proteins and contributes to E6/E6-AP-induced ubiquitination of p53/TP53. UbcH5b/UBE2D2 Protein, Human is the recombinant human-derived UbcH5b/UBE2D2 protein, expressed by E. coli , with tag free. The total length of UbcH5b/UBE2D2 Protein, Human is 147 a.a., with molecular weight of ~16 kDa.

The UbcH5b/UBE2D2 protein serves as a crucial mediator in cellular processes, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to various proteins. With a pronounced preference for 'Lys-48'-linked polyubiquitination, UbcH5b/UBE2D2 demonstrates its versatility in modifying target proteins. Beyond its catalytic role, it plays a central part in the selective degradation of short-lived and aberrant proteins. UbcH5b/UBE2D2 is instrumental in the E6/E6-AP-induced ubiquitination of p53/TP53 and is involved in the ubiquitination of PEX5, as well as the autoubiquitination of STUB1 and TRAF6. Its engagement extends to signal-induced processes, including the conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53, and the activation of MAVS in the mitochondria by RIGI in response to viral infection. Moreover, UbcH5b/UBE2D2 proves to be essential for the viral activation of IRF3.

Recombinant Human UbcH5b/UBE2D2 is a member of the Ubiquitin-conjugating (E2) enzyme family that receives Ubiquitin from a Ubiquitin-activating (E1) enzyme and subsequently interacts with a Ubiquitin ligase (E3) to conjugate Ubiquitin to substrate proteins.

Human

E. coli

Tag Free

P62837-1 (M1-M147)

7322  [NCBI]

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 50 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.