1. Recombinant Proteins
  2. Viral Proteins
  3. Zika Virus Proteins
  4. Zika Virus E proteins
  5. Zika virus E/Envelope Protein (HEK293, His)

Zika virus E/Envelope Protein (HEK293, His)

Cat. No.: HY-P74456
COA Handling Instructions

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag. The total length of Zika virus E/Envelope Protein (HEK293, His) is 107 a.a., with molecular weight of ~13 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $95 In-stock
10 μg $160 In-stock
20 μg $245 In-stock
50 μg $465 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag. The total length of Zika virus E/Envelope Protein (HEK293, His) is 107 a.a., with molecular weight of ~13 kDa.

Background

Genome polyprotein is a series of protein units with similar or different functions that have been widely utilized by single-celled or multi-cellular organisms as concentrators of countless molecular activities. Genome polyprotein is a small protein chain that is covalently linked, and it is a common means of organizing the protein set of viruses (including HIV) in nature. As the signal peptide of NS4B, genome polyprotein is essential for the anti-interferon activity of NS4B. Genome polyprotein inhibits RNA silencing by interfering with host Dicer. Genome polyprotein may play a role in viral budding. Genome polyprotein exerts cytotoxic effects by activating the mitochondrial apoptosis pathway through the M ectodomain. Genome polyprotein may display viral protein activity[1][2].

Species

Virus

Source

HEK293

Tag

C-His

Accession

ALU33341.1 (V593-K699)

Gene ID

/

Molecular Construction
N-term
Envelope (V593-K699)
Accession # ALU33341.1
His
C-term
Synonyms
Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope protein (Domain III, His)
AA Sequence

VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK

Molecular Weight

Approximately 13 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Zika virus E/Envelope Protein (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Zika virus E/Envelope Protein (HEK293, His)
Cat. No.:
HY-P74456
Quantity:
MCE Japan Authorized Agent: