ZNF75A Protein, Human (His)

The ZNF75A protein appears to be a potential influencer of transcriptional regulation, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF75A are not fully understood, its multifunctional nature in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF75A Protein, Human (His) is the recombinant human-derived ZNF75A protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZNF75A Protein, Human (His) is 105 a.a., with molecular weight of ~14.0 kDa.

The ZNF75A protein emerges as a potential contributor to transcriptional regulation, suggesting its likely involvement in modulating gene expression. While the specific mechanisms and target genes influenced by ZNF75A remain to be fully elucidated, its association with transcriptional processes implies a role in shaping cellular functions through the control of gene expression. The versatile nature of ZNF75A within the realm of transcriptional regulation hints at its potential impact on diverse cellular pathways, making it a compelling candidate for further investigation to unravel its role in the intricate dynamics of gene regulation and the maintenance of cellular homeostasis.

Human

E. coli

N-6*His

Q96N20 (S58-K162)

7627  [NCBI]

SPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFK

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.