Search Result

Results for "

amino-acid

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Amino Acid Derivatives (1183) EAAT (1) 5-HT Receptor (2) ADC Linker (1) Amyloid-β (1) Angiotensin-converting Enzyme (ACE) (2) Antibiotic (3) Apoptosis (3) Autophagy (2) Bacterial (7) Biochemical Assay Reagents (20) CaMK (2) Caspase (1) Cathepsin (2) CGRP Receptor (2) Chloride Channel (1) CRFR (2) CXCR (2) Dopamine Receptor (1) Drug Metabolite (2) Endogenous Metabolite (12) Endothelin Receptor (1) Ferroportin (1) Fluorescent Dye (3) Fungal (2) GCGR (5) GLP Receptor (8) Glucosidase (1) HIV (1) iGluR (5) Integrin (1) MCHR1 (GPR24) (2) MMP (2) Neurokinin Receptor (1) Oxytocin Receptor (1) P-glycoprotein (1) PACAP Receptor (1) PAI-1 (1) PD-1/PD-L1 (2) Phospholipase (2) PKC (2) PKG (1) Potassium Channel (2) RABV (2) Raf (1) Ras (1) Reactive Oxygen Species (2) Ser/Thr Protease (1) Somatostatin Receptor (3) STAT (1) Taste Receptor (1) TRP Channel (2) Tryptophan Hydroxylase (1) Vasopressin Receptor (5) VEGFR (1)
By Research Areas:	Cancer (26) Cardiovascular Disease (11) Endocrinology (5) Infection (16) Inflammation/Immunology (13) Metabolic Disease (31) Neurological Disease (30)
Click Chemistry:	Azide (3) Alkynes (6)

1301

Inhibitors & Agonists

Fluorescent Dye

Biochemical Assay Reagents

1368

Peptides

Natural
Products

Antibodies

Click Chemistry

Targets Recommended: Amino Acid Derivatives EAAT Hydroxycarboxylic Acid Receptor (HCAR) Free Fatty Acid Receptor Fatty Acid Synthase (FASN) Apical Sodium-Dependent Bile Acid Transporter G protein-coupled Bile Acid Receptor 1

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P4146

Survodutide BI 456906	GLP Receptor GCGR	Metabolic Disease
Survodutide (BI 456906) is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC₅₀s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .

HY-P4146A

Survodutide TFA BI 456906 TFA	GLP Receptor GCGR	Metabolic Disease
Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC₅₀s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .

HY-P3581

PE 22-28	Potassium Channel	Neurological Disease
PE 22-28 is a TREK-1 inhibitor with IC₅₀ value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .

HY-P1511

PACAP-Related Peptide (PRP), human

PACAP Receptor Neurological Disease

PACAP-Related Peptide (PRP), human is a 29 amino-acid region of the PACAP precursor protein.

PACAP-Related Peptide (PRP), human	PACAP Receptor	Neurological Disease
PACAP-Related Peptide (PRP), human is a 29 amino-acid region of the PACAP precursor protein.

HY-P0173A

Chlorotoxin	Chloride Channel	Cancer
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.

HY-P2207

Sinapultide	Biochemical Assay Reagents	Others
Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement .

HY-P3811

Autocamtide-3

CaMK Neurological Disease

Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca ²⁺/calmodulin-dependent kinase II) (CaMK) substrate .

Autocamtide-3	CaMK	Neurological Disease
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca ²⁺/calmodulin-dependent kinase II) (CaMK) substrate .

HY-P3811A

Autocamtide-3 acetate	CaMK	Neurological Disease
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca ²⁺/calmodulin-dependent kinase II) (CaMK) substrate .

HY-P0285

Rabies Virus Glycoprotein	RABV	Infection
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.

HY-P2207A

Sinapultide TFA	Biochemical Assay Reagents	Others
Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement .

HY-P0285A

Rabies Virus Glycoprotein TFA 1 Publications Verification	RABV	Infection
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .

HY-111149

PS372424	CXCR	Inflammation/Immunology
PS372424, a three amino-acid fragment of CXCL10, is a specific human CXCR3 agonist with anti-inflammatory activity. PS372424 prevents human T-cell migration in a humanized model of arthritic inflammation .

HY-111149A

PS372424 hydrochloride 1 Publications Verification	CXCR	Inflammation/Immunology
PS372424 hydrochloride, a three amino-acid fragment of CXCL10, is a specific human CXCR3 agonist with anti-inflammatory activity. PS372424 hydrochloride prevents human T-cell migration in a humanized model of arthritic inflammation .

HY-P1714

Apraglutide FE 203799	GLP Receptor	Metabolic Disease
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .

HY-P1714A

Apraglutide TFA FE 203799 TFA	GLP Receptor	Metabolic Disease
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .

HY-P1298

Sauvagine	CRFR	Cardiovascular Disease Neurological Disease Endocrinology
Sauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .

HY-P1293

Conantokin G	iGluR	Neurological Disease
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC₅₀ of 480 nM. Conantokin G has neuroprotective properties .

HY-P1298A

Sauvagine TFA	CRFR	Cardiovascular Disease Neurological Disease Endocrinology
Sauvagine TFA, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine TFA is effective at releasing ACTH from rat pituitary cells. Sauvagine TFA possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .

HY-P1293A

Conantokin G TFA	iGluR	Neurological Disease
Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC₅₀ of 480 nM. Conantokin G TFA has neuroprotective properties .

HY-P1525

Melanin Concentrating Hormone, salmon MCH (salmon)	MCHR1 (GPR24)	Cardiovascular Disease Neurological Disease Metabolic Disease Endocrinology
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.

HY-105037

Forigerimod IPP-201101	Autophagy	Inflammation/Immunology
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy. Forigerimod can be used for the research of autoimmune disorders, such as systemic lupus erythematosus (SLE) .

HY-P1674A

Murepavadin TFA 2 Publications Verification POL7080 TFA	Bacterial Antibiotic	Infection
Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC₅₀ and MIC₉₀ values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .

HY-P2230

Angstrom6 A6 Peptide	PAI-1	Cancer
Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling .

HY-P1674

Murepavadin POL7080	Bacterial Antibiotic	Infection
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC₅₀ and MIC₉₀ values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .

HY-P10341

ZP3022	GCGR	Metabolic Disease
ZP3022 is a dual agonist of glucagon-like peptide-1 (GLP-1) and gastrin, which has the ability to continuously improve glycemic control. Meanwhile, ZP3022 can effectively increase the mass of β-cells, promote β-cell proliferation, and enhance the average islet mass. ZP3022 can be used in research for anti-diabetic treatments .

HY-P1525A

Melanin Concentrating Hormone, salmon TFA MCH (salmon) (TFA)	MCHR1 (GPR24)	Cardiovascular Disease Neurological Disease Metabolic Disease Endocrinology
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.

HY-105037A

Forigerimod TFA IPP-201101 TFA	Autophagy	Inflammation/Immunology
Forigerimod TFA (IPP-201101 TFA) is a CD4 T-cell modulator. Forigerimod TFA is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod TFA can potently inhibit autophagy. Forigerimod can be used for the research of autoimmune disorders, such as systemic lupus erythematosus (SLE) .

HY-P10218A

MANS peptide TFA	PKC	Inflammation/Immunology Cancer
MANS peptide TFA is the TFA salt form of MANS peptide (HY-P10218). MANS peptide TFA is an inhibitor for myristoylated alanine-rich C kinase substrate (MARCKS), which competes with MARCKS in cells for membrane binding, and thus inhibits the stimulation of mucin secretion and tumor metastasis .

HY-P10218

MANS peptide	PKC	Inflammation/Immunology Cancer
MANS peptide is an inhibitor for myristoylated alanine-rich C kinase substrate (MARCKS), which competes with MARCKS in cells for membrane binding, and thus inhibits the stimulation of mucin secretion and tumor metastasis .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P3906

Melittin free acid	Fungal Apoptosis Phospholipase Reactive Oxygen Species	Infection
Melittin free acid is a basic 26-amino-acid polypeptide, the major active ingredient of honeybee venom. Melittin free acid is an activator of phospholipase A2 (PLA2). Melittin free acid has broad-spectrum antifungal activity with MIC values of 0.4-60 μM. Melittin free acid hinders fungal growth by inducing cell apoptosis, repressing (1,3)-β-D-glucan synthase and participating in other pathways .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P10318

SHR-2042	GLP Receptor	Endocrinology
SHR-2042 is a selective agonist of the GLP-1 receptor.SHR-2042 improves glycemic control by activating the GLP-1 receptor, enhancing insulin secretion and inhibiting glucagon secretion. SHR-2042 combined with sodium N-(8-[2-hydroxybenzoyl] amino) caprylate (SNAC) promotes monomerization through the formation of micelles and improves oral absorption efficiency .

HY-P10200

CP7-FP13-2	Bacterial	Infection
CP7-FP13-2 is a peptide with antivirulence factor and antibacterial activity. CP7-FP13-2 inhibits the formation of Staphylococcus aureus biofilm and has good antibacterial efficacy in mice .

HY-P0041

F992

Vasopressin Receptor Neurological Disease

F992 is an antidiuretic peptide and vasopressin (antidiuretic hormone) analogue .
HY-P0041A

F992 TFA

Vasopressin Receptor Neurological Disease

F992 TFA is an antidiuretic peptide and vasopressin (antidiuretic hormone) analogue .

F992	Vasopressin Receptor	Neurological Disease
F992 is an antidiuretic peptide and vasopressin (antidiuretic hormone) analogue .

F992 TFA	Vasopressin Receptor	Neurological Disease
F992 TFA is an antidiuretic peptide and vasopressin (antidiuretic hormone) analogue .

HY-P3462

Cagrilintide	CGRP Receptor	Metabolic Disease
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .

HY-P3462A

Cagrilintide acetate	CGRP Receptor	Metabolic Disease
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .

HY-P5161A

FC382K10W15 TFA

GCGR Metabolic Disease

FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research .

FC382K10W15 TFA	GCGR	Metabolic Disease
FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research .

HY-P10271

RG7697	GLP Receptor	Metabolic Disease
RG7697 is a dual agonist for glucagon-like peptide receptor (GLP Receptor) and glucosedependent insulinotropic polypeptide receptor (GIPR), with EC₅₀ of 5 and 3 pM, respectively. RG7697 exhibits antihyperglycemic property .

HY-P3143

BMSpep-57	PD-1/PD-L1	Cancer
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC₅₀ of 7.68 nM. BMSpep-57 binds to PD-L1 with K_ds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 facilitates T cell function by in creasing IL-2 production in PBMCs .

HY-P3143A

BMSpep-57 hydrochloride	PD-1/PD-L1	Cancer
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC₅₀ of 7.68 nM. BMSpep-57 hydrochloride binds to PD-L1 with K_ds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .

HY-113560

Plipastatin B1

Antibiotic Fungal Phospholipase Infection

Plipastatin B1 is a lipopeptide antibiotic, an inhibitor of phospholipase A₂ (PLA2), which has antifungal activity .

Plipastatin B1	Antibiotic Fungal Phospholipase	Infection
Plipastatin B1 is a lipopeptide antibiotic, an inhibitor of phospholipase A₂ (PLA2), which has antifungal activity .

HY-P1162

(d(CH2)51,Tyr(Me)2,Arg8)-Vasopressin SKF 100273	Vasopressin Receptor	Metabolic Disease
(d(CH2)51,Tyr(Me)2,Arg8)-Vasopressin (SKF 100273) is a vasopressin V1 receptor selective antagonist .

HY-P2434

AP102	Somatostatin Receptor	Neurological Disease Metabolic Disease Cancer
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC₅₀: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .

HY-P10031

SAR441255	GLP Receptor GCGR	Metabolic Disease
SAR441255 is a potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist. SAR441255 displays high potency with balanced activation of all three target receptors.?SAR441255 shows positive acute glucoregulatory effectss in diabetic obese monkeys .

HY-P10031A

SAR441255 TFA	GLP Receptor	Metabolic Disease
SAR441255 TFA is a potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist. SAR441255 TFA displays high potency with balanced activation of all three target receptors.?SAR441255 TFA shows positive acute glucoregulatory effectss in diabetic obese monkeys .

HY-P4895

(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin	Oxytocin Receptor	Neurological Disease
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .

HY-P10272

Rusfertide PTG-300	Ferroportin	Others
Rusfertide is a peptide mimetic of natural hepcidin, which targets and degrades ferroportin, reduces serum iron and transferrin-saturation, and thus regulates the production of red blood cells. Rusfertide ameliorates the polycythemia vera, β-thalassemia and hereditary hemochromatosis .

HY-P5362

NODAGA-LM3	Somatostatin Receptor	Cancer
NODAGA-LM3 can be labeled by ⁶⁸Ga for PET imaging. ⁶⁸Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .

Cat. No.	Product Name		Classification

HY-W006064

(S)-2-Aminopent-4-ynoic acid		Alkynes
(S)-2-Aminopent-4-ynoic acid is a synthetic amino acid. (S)-2-Aminopent-4-ynoic acid can be used in synthesis of folate-conjugates and corresponding metal-chelate complexes . (S)-2-Aminopent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W048205

N6-Diazo-L-Fmoc-lysine		Azide
N6-Diazo-L-Fmoc-lysine is an active compand and can be used in a variety of chemical studies. N6-Diazo-L-Fmoc-lysine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.

HY-W142062

cis-Fmoc-Pro(4-N3)-OH		Azide
cis-Fmoc-Pro(4-N3)-OH is a proline derivative . cis-Fmoc-Pro(4-N3)-OH is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.

HY-W040124

DL-Propargylglycine		Alkynes
DL-Propargylglycine is a Glycine (HY-Y0966) derivative . DL-Propargylglycine is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W008395

Fmoc-D-Pra-OH		Alkynes
Fmoc-D-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-D-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W011210

Fmoc-Pra-OH		Alkynes
Fmoc-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W014258

*(R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid*		Alkynes
(R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W014259

*(S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid*		Alkynes
(S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-151641

3-Azido-L-alanine		Azide
3-Azido-L-alanine is an aliphatic functionalized amino acid with side chain lengths of up to four carbons . 3-Azido-L-alanine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:


Products	In-stock - + Add to Cart
Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

amino-acid

Inhibitors & Agonists

Fluorescent Dye

Biochemical Assay Reagents

Peptides

NaturalProducts

Antibodies

Click Chemistry

Natural
Products