1. Search Result
Search Result
Results for "

infiltration

" in MedChemExpress (MCE) Product Catalog:

49

Inhibitors & Agonists

3

Peptides

3

Inhibitory Antibodies

2

Natural
Products

1

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-15178

    GRC 3886

    Phosphodiesterase (PDE) Inflammation/Immunology
    Oglemilast (GRC 3886) is a potent and orally active phosphodiesterase-4 (PDE4) inhibitor with an IC50 of 0.5 nM for PDE4D3. Oglemilast inhibits pulmonary cell infiltration, including eosinophilia and neutrophilia in vitro and in vivo. Oglemilast has the potential for inflammatory airway diseases .
    Oglemilast
  • HY-14277A

    R 50547 hydrochloride

    Histamine Receptor Neurotensin Receptor Integrin Inflammation/Immunology
    Levocabastine (R 50547) hydrochloride is a potent and selective histamine H1-receptor antagonist. Levocabastine hydrochloride is also a selective, high affinity neurotensin receptor subtype 2 (NTR2) antagonist, with a Ki of 17 nM for mNTR2. Levocabastine hydrochloride can act as a VLA-4 antagonist, interferes with conjunctival eosinophil infiltration in allergic conjunctivitis (AC) .
    Levocabastine hydrochloride
  • HY-P5875

    Protease Activated Receptor (PAR) Inflammation/Immunology
    P4pal10 is a PAR4 antagonist. P4pal10 prevents the thrombin-mediated aggregation of mouse platelets in vivo. P4pal10 significantly reduced both the oedema and the granulocyte infiltration induced by Carrageenan (HY-125474) .
    P4pal10
  • HY-14277

    R 50547

    Histamine Receptor Neurotensin Receptor Integrin Inflammation/Immunology
    Levocabastine (R 50547) is a potent and selective histamine H1-receptor antagonist. Levocabastine hydrochloride is also a selective, high affinity neurotensin receptor subtype 2 (NTR2) antagonist, with a Ki of 17 nM for mNTR2. Levocabastine can act as a VLA-4 antagonist, interferes with conjunctival eosinophil infiltration in allergic conjunctivitis (AC) .
    Levocabastine
  • HY-112742

    Leukotriene Receptor Inflammation/Immunology
    CP-195543 is a potent, selective and orally active leukotriene B4 (LTB4) receptor antagonist with IC50s of 6.8, 37.0 nM for human neutrophils and murine spleen membranes, respectively. CP-195543 blocks CD11b up-regulation. CP-195543 inhibits LTB4-mediated neutrophil infiltration .
    CP-195543
  • HY-146421

    NO Synthase NF-κB Reactive Oxygen Species Inflammation/Immunology
    Anti-inflammatory agent 21 (compound 9o) is an orally active and low cytotoxic anti-inflammatory agent, with an IC50 value of 0.76 μM for NO. Anti-inflammatory agent 21 acts via accumulation ROS and blocks the NF-κB/MAPK signaling pathway. Anti-inflammatory agent 21 can ameliorate cartilage destruction and inflammatory cell infiltration in arthritis rats model .
    Anti-inflammatory agent 21
  • HY-162415

    c-Fms Apoptosis Cancer
    CSF1R-IN-22 (Compound C19) is an orally effective CSF-1R selective inhibitor (IC50<6 nM). CSF1R-IN-22 enhances the secretion of CXCL9 from M2 macrophages, increases CD8 + T cell infiltration. CSF1R-IN-22 boosts anti-tumor immune responses of anti-PD-1, and induces apoptosis in tumor cells. CSF1R-IN-22 can effectively reprogram M2-like TAMs (tumor-associated macrophages) to the M1 phenotype and reshape the TME by inducing the recruitment of CD8 + T cells into tumors and reducing the infiltration of immunosuppressive Tregs and MDSCs .
    CSF1R-IN-22
  • HY-162264

    Microtubule/Tubulin Proton Pump Apoptosis Inflammation/Immunology Cancer
    Tubulin polymerization/V-ATPase-IN-1 (compound F10) is a Tubulin polymerization/V-ATPase inhibitor. Tubulin polymerization/V-ATPase-IN-1 shows robust antiproliferation activity against four human cancer cell lines, and exerts antiproliferative activity by inhibiting tubulin and V-ATPase. Tubulin polymerization/V-ATPase-IN-1 induces immunogenic cell death in addition to apoptosis, and inhibits tumor growth in an RM-1 homograft model with enhanced T lymphocyte infiltration .
    Tubulin polymerization/V-ATPase-IN-1
  • HY-139874

    CXCR Inflammation/Immunology Cancer
    CXCR2 antagonist 3 (compound 11h) is a potent antagonist of CXC chemokine receptor 2 (CXCR2). CXCR2 antagonist 3 demonstrates double-digit nanomolar potencies against CXCR2 and significantly inhibited neutrophil infiltration into the air pouch. CXCR2 antagonist 3 reduces the infiltration of neutrophils and MDSCs and enhance the infiltration of CD3 + T lymphocytes into the Pan02 tumor tissues .
    CXCR2 antagonist 3
  • HY-N12840

    Others Metabolic Disease
    Logmalicid B is an iridoid glycoside compound that can be isolated from Cornus officinalis and can be used in diabetes research .
    Logmalicid B
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Others
    Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
    Met-RANTES (human)
  • HY-109151

    E6007

    Others Inflammation/Immunology
    Milategrast is useful as cell adhesion inhibitor or cell infiltration inhibitor. Milategrast in vitro inhibites the adhesion of Jurkat cells to human fibronectin with an IC50 of <5 μM .
    Milategrast
  • HY-P99565

    ARENEGYR; NGR-TNF; NGR-hTNF

    TNF Receptor Cancer
    Tengonermin (ARENEGYR) is a vascular-targeting agent consisting of the human Tumour Necrosis Factor-α (TNF-α) conjugated with the CNGRCG peptide. Tengonermin increases penetration of intratumoral chemotherapy and T-cell infiltration by modifying the tumour microenvironment .
    Tengonermin
  • HY-160768

    Deubiquitinase Inflammation/Immunology Cancer
    OTUB2-IN-1, a specific inhibitor of OTUB2 (KD: ~12 μM), reduces PD-L1 protein expression in tumor cells and inhibits tumor growth by promoting robust intra-tumor infiltration of cytotoxic T lymphocytes (CTL) .
    OTUB2-IN-1
  • HY-P99886

    h5G1. 1-SC

    Complement System Apoptosis Cardiovascular Disease Neurological Disease
    Pexelizumab (h5G1. 1-SC) is a humanized scFv monoclonal antibody directed against the C5 complement component. Pexelizumab inhibits apoptosis and leukocyte infiltration. Pexelizumab can be used for the research of cerebral IR injury and myocardial infarction .
    Pexelizumab
  • HY-145855

    TGF-β Receptor Inflammation/Immunology
    J-1063 is a potent, selective and orally active ALK5 inhibitor with an IC50 of 0.039 µM. J-1063 shows anti-fibrotic effect by the inhibition of inflammatory infiltration, collagen deposition, and hepatocytes necrosis. J-1063 has the potential for the research of liver fibrosis .
    J-1063
  • HY-153991

    STAT Inflammation/Immunology
    STAT6-IN-2 (Comp R-84) is an inhibitor of STAT6. STAT6-IN-2 inhibits the secretion of chemokine eliciting eosinophil infiltration eotaxin-3. STAT6-IN-2 can be used for immune disease research .
    STAT6-IN-2
  • HY-W015445

    p38 MAPK Metabolic Disease
    SD-169 is an orally active ATP-competitive inhibitor of p38α MAPK, with an IC50 of 3.2 nM. SD-169 also weakly inhibits p38β MAPK with an IC50 of 122 nM. SD-169 prevents the development and progression of diabetes by inhibiting T cell infiltration and activation .
    SD-169
  • HY-128171
    Diflapolin
    1 Publications Verification

    FLAP Epoxide Hydrolase Inflammation/Immunology
    Diflapolin is a highly active dual 5-lipoxygenase-activating protein (FLAP)/soluble epoxide hydrolase (sEH) inhibitor with marked anti-inflammatory efficacy and high target selectivity. Diflapolin inhibits 5-LOX product formation in intact human monocytes and neutrophils with IC50s of  30 and 170 nM, respectively, and suppressed the activity of isolated sEH (IC50=20 nM) .
    Diflapolin
  • HY-134772

    STAT Cytochrome P450 Inflammation/Immunology
    AS1810722 is an orally active and potent STAT6 inhibitor with an IC50 of 1.9 nM. AS1810722 shows a good profile of CYP3A4 inhibition. AS1810722, a derivative of fused bicyclic pyrimidine, has the potential for allergic diseases such as asthma and atopic diseases research .
    AS1810722
  • HY-P99259

    FPA 008; Anti-Human CSF1R Recombinant Antibody

    c-Fms Inflammation/Immunology Cancer
    Cabiralizumab (FPA 008) is an anti-CSF1R monoclonal antibody (MAb). Cabiralizumab enhances T cell infiltration and antitumor T cell immune responses. Cabiralizumab inhibits the activation of osteoclasts and blocks bone destruction, and can be used in the research of rheumatoid arthritis (RA). Cabiralizumab can combine with Nivolumab (HY-P9903) for lung cancer research .
    Cabiralizumab
  • HY-153358

    HDAC Cancer
    TNG260 is a CoREST-selective deacetylase (CoreDAC) inhibitor. TNG260 inhibits HDAC1 with 10-fold selectivity over HDAC3. TNG260 leads to HDAC1 inhibition, reverses anti-PD1 resistance driven by loss of STK11. TNG260 decreases intratumoral infiltration of neutrophils. TNG260 exhibits immune-mediated cell killing .
    TNG260
  • HY-105017

    ATL 313; DE 112

    Adenosine Receptor Infection Inflammation/Immunology
    Evodenoson is a selective agonist of the A2A adenosine receptor. Evodenoson’s primary actions include reducing inflammatory responses, decreasing intestinal fluid secretion, edema, tissue damage, and neutrophil infiltration induced by Clostridium difficile toxin A. Evodenoson’s protective effect is achieved by reducing myeloperoxidase (MPO) and adenosine deaminase (ADA) activities, and by lowering the production of tumor necrosis factor-alpha (TNF-α) .
    Evodenoson
  • HY-161518

    PD-1/PD-L1 Cancer
    PD-1/PD-L1-IN-44 (Compound 22) selectively inhibits PD-1/PD-L1 proteins (IC50=1.21 nM). PD-1/PD-L1-IN-44 inhibits tumor growth without toxicity in animal models and increases CD8 + cell infiltration .
    PD-1/PD-L1-IN-44
  • HY-13315
    Montelukast sodium
    Maximum Cited Publications
    8 Publications Verification

    MK0476

    Leukotriene Receptor Inflammation/Immunology
    Montelukast sodium (MK0476) is a potent, selective and orally active antagonist of cysteinyl leukotriene receptor 1 (CysLT1). Montelukast sodium can be used for the reseach of asthma and liver injury. Montelukast sodium also has an antioxidant effect in intestinal ischemia-reperfusion injury, and could reduce cardiac damage. Montelukast sodium decreases eosinophil infiltration into the asthmatic airways. Montelukast sodium can also be used for COVID-19 research .
    Montelukast sodium
  • HY-19443

    Histamine Receptor Lipoxygenase Inflammation/Immunology
    UCB-35440 is an orally active histamine H1 receptor antagonist and 5-lipoxygenase inhibitor. UCB-35440 inhibits LTB4 formation in human whole blood and reduces polymorphonuclear cell infiltration in mouse models. UCB-35440 inhibits histamine-stimulated bronchoconstriction and reduces skin inflammation in guinea pigs. UCB-35440 can be used for research on asthma and skin inflammation .
    UCB-35440
  • HY-B0517A

    Sodium Channel Neurological Disease
    Mepivacaine hydrochloride binds to specific voltage-gated sodium ion channels in neuronal cell membranes, which inhibits both sodium influx and membrane depolarization .
    Mepivacaine hydrochloride
  • HY-107591B

    IKK Inflammation/Immunology
    PF-184 is a potent and selective IKK-2 inhibitor (IC50: 37 nM) over rhIKK-1, IKKi, and more than 30 tyrosine and serine/threonine kinases. PF-184 can be used in the research of inflammation, such as asthma and chronic obstructive pulmonary disease .
    PF-184
  • HY-N8278

    Thrombin Cardiovascular Disease Inflammation/Immunology
    Dermatan sulphate sodium is a glycosaminoglycan and thrombin inactivator with antithrombotic activity. Dermatan sulphate sodium selectively catalyzes the inactivation of thrombin by heparin cofactor II and does not interact with antithrombin III. Dermatan sulphate sodium is highly bioavailable and also reduces Bleomycin (HY-108345)-induced pulmonary fibrosis damage .
    Dermatan sulphate sodium
  • HY-113533

    RvD4

    Bacterial Inflammation/Immunology
    Resolvin D4 (RvD4), a specialized proresolving mediator, can be produced in bioactive levels during S. aureus infection .
    Resolvin D4
  • HY-13315A
    Montelukast
    Maximum Cited Publications
    8 Publications Verification

    MK0476 free base

    Leukotriene Receptor Inflammation/Immunology
    Montelukast (MK0476 free base) is a potent, selective and orally active antagonist of cysteinyl leukotriene receptor 1 (CysLT1). Montelukast can be used for the reseach of asthma and liver injury. Montelukast also has an antioxidant effect in intestinal ischemia-reperfusion injury, and could reduce cardiac damage. Montelukast decreases eosinophil infiltration into the asthmatic airways. Montelukast can also be used for COVID-19 research .
    Montelukast
  • HY-15131

    Interleukin Related Inflammation/Immunology
    PNRI-299 is a selective AP-1 transcription inhibitor with an IC50 of 20 uM. PNRI-299 is a selective APE/Ref-1 inhibitor. PNRI-299 has no effect on NF-κB transcription or thioredoxin (up to 200 uM). PNRI-299 significantly reduces airway eosinophil infiltration, mucus hypersecretion, edema, and IL-4 levels in a mouse asthma model .
    PNRI-299
  • HY-116953

    LXB4

    Endogenous Metabolite Inflammation/Immunology
    Lipoxin B4 (LXB4) is a structurally distinct product of arachidonic acid metabolism. Lipoxin B4 reduces leukocyte infiltration and mucus secretion in the nasal mucosa and decreases mast cell and eosinophil degranulation in the upper airway. Lipoxin B4 decreases airway inflammation, mucus metaplasia and hyper- responsiveness in the lower airway. Lipoxin B4 shows mucosal protective actions and has the potential for the research of allergic inflammation in the upper and lower airways .
    Lipoxin B4
  • HY-13508

    Histamine Receptor Inflammation/Immunology
    JNJ-7777120 is a potent and selective histamine H4 receptor antagonist (Ki=4.5 nM). JNJ-7777120 effectively blocks histamine-induced migration of mouse tracheal mast cells from connective tissue to epithelial cells. JNJ-7777120 also significantly blocks neutrophil infiltration in a mouse Zymosan-induced peritonitis model. JNJ-7777120 has a good potential to study antipruritic and anti-inflammatory .
    JNJ-7777120
  • HY-123986
    CTPI-2
    5+ Cited Publications

    Mitochondrial Metabolism Inflammation/Immunology Cancer
    CTPI-2 is a third-generation mitochondrial citrate carrier SLC25A1 inhibitor with a KD of 3.5 μM. CTPI-2 inhibits glycolysis, PPARγ, and its downstream target the glucose transporter GLUT4. CTPI-2 halts salient alterations of NASH reverting steatosis, preventing the evolution to steatohepatitis, reducing inflammatory macrophage infiltration in the liver and adipose tissue, and starkly mitigating obesity induced by a high-fat diet. Antitumor activity .
    CTPI-2
  • HY-13315B

    MK0476 dicyclohexylamine

    Leukotriene Receptor Inflammation/Immunology
    Montelukast (MK0476) dicyclohexylamine is a potent, selective and orally active antagonist of cysteinyl leukotriene receptor 1 (CysLT1). Montelukast dicyclohexylamine can be used for the reseach of asthma and liver injury. Montelukast dicyclohexylamine also has an antioxidant effect in intestinal ischemia-reperfusion injury, and could reduce cardiac damage. Montelukast dicyclohexylamine decreases eosinophil infiltration into the asthmatic airways. Montelukast dicyclohexylamine can also be used for COVID-19 research .
    Montelukast dicyclohexylamine
  • HY-148552

    p38 MAPK ERK NF-κB Interleukin Related TNF Receptor Inflammation/Immunology
    Anti-inflammatory agent 35 (compound 5a27) is an orally active curcumin analogue with anti-inflammatory activity. Anti-inflammatory agent 35 blocks mitogen-activated protein kinase (MAPK) signaling and p65 nuclear translocation of NF-kB. Anti-inflammatory agent 35 also inhibits yellow neutrophil infiltration and pro-inflammatory cytokine production. Anti-inflammatory agent 35 significantly attenuates lipopolysaccharide (LPS)-induced acute lung injury (ALI) in vivo .
    Anti-inflammatory agent 35
  • HY-153358A

    HDAC Cancer
    (S)-TNG260 is an isomer of TNG260 (HY-153358). TNG260 is a CoREST selective deacetylase (CoreDAC) inhibitor. TNG260 inhibits HDAC1 with 10-fold selectivity over HDAC3. TNG260 causes HDAC1 inhibition and reverses anti-PD1 resistance driven by STK11 deletion. TNG260 reduces intratumoral infiltration of neutrophils. TNG260 exhibits immune-mediated cell killing.
    (S)-TNG260
  • HY-N7384A

    Pangamic Acid hemicalcium

    Others Neurological Disease Metabolic Disease Inflammation/Immunology Cancer
    Vitamin B15 (Pangamic Acid) hemicalcium is a natural, ubiquitously in plant seeds substance and can used be as an agent stimulating cellular respiration. Vitamin B15 hemicalcium contains D-gluconodimethyl amino acetic acid. Vitamin B15 hemicalcium is also a immune-correcting agent . Vitamin B15 hemicalcium can be used for wide range of diseases.
    Vitamin B15 hemicalcium
  • HY-13315R

    MK0476 (Standard)

    Leukotriene Receptor Inflammation/Immunology
    Montelukast (sodium) (Standard) is the analytical standard of Montelukast (sodium). This product is intended for research and analytical applications. Montelukast sodium (MK0476) is a potent, selective and orally active antagonist of cysteinyl leukotriene receptor 1 (CysLT1). Montelukast sodium can be used for the reseach of asthma and liver injury. Montelukast sodium also has an antioxidant effect in intestinal ischemia-reperfusion injury, and could reduce cardiac damage. Montelukast sodium decreases eosinophil infiltration into the asthmatic airways. Montelukast sodium can also be used for COVID-19 research .
    Montelukast sodium (Standard)
  • HY-144746

    PD-1/PD-L1 Cancer
    PD-1/PD-L1-IN-26 (Compound II-14) is a potent inhibitor of PD-1/PD-L1 with an IC50 of 0.0380 μM. PD-1/PD-L1-IN-26 activates the immune microenvironment by promoting the infiltration of CD4+ T cells into tumor tissues. PD-1/PD-L1-IN-26 has the potential for the research of cancer diseases .
    PD-1/PD-L1-IN-26
  • HY-13315AR

    Leukotriene Receptor Inflammation/Immunology
    Montelukast (Standard) is the analytical standard of Montelukast. This product is intended for research and analytical applications. Montelukast (MK0476 free base) is a potent, selective and orally active antagonist of cysteinyl leukotriene receptor 1 (CysLT1). Montelukast can be used for the reseach of asthma and liver injury. Montelukast also has an antioxidant effect in intestinal ischemia-reperfusion injury, and could reduce cardiac damage. Montelukast decreases eosinophil infiltration into the asthmatic airways. Montelukast can also be used for COVID-19 research .
    Montelukast (Standard)
  • HY-145801

    Others Inflammation/Immunology
    XT2 is a potent, orally active, and selective inhibitor of NF-κB-inducing kinase (NIK) with an IC50 of 9.1 nM. XT2 suppresses CCl4-induced upregulation of ALT, a key biomarker of acute liver injury. XT2 also decreases immune cell infiltration into the injured liver tissue. XT2 has the potential for the research of liver inflammatory diseases . XT2 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
    XT2
  • HY-157569

    PD-1/PD-L1 Cancer
    PD1-PDL1-IN 2 (ZE132) is a potent and selective PD-1/PD-L1 inhibitor, which has robust anti-tumour activity in vivo. PD1-PDL1-IN 2 promotes cytotoxic T-cell tumour infiltration and induces IL-2 expression. In addition, PD1-PDL1-IN 2 elicits strong inhibitory effects on the mRNA expression of TGF-β .
    PD1-PDL1-IN 2
  • HY-114041

    RvE1

    Endogenous Metabolite Inflammation/Immunology
    Resolvin E1 (RvE1), a potent endogenous pro-resolving mediator of inflammation, is derived from omega-3 fatty acid eicosapentaenoic acid (EPA). Resolvin E1 is endogenously biosynthesized from EPA in the presence of Aspirin during the spontaneous resolution phase of acute inflammation, where specific cell-cell interactions occur. Resolvin E1 possesses unique counterregulatory actions that inhibit polymorphonuclear leukocyte (PMN) transendothelial migration. Resolvin E1 also acts as a potent inhibitor of leukocyte infiltration, dendritic cell migration, and IL-12 production .
    Resolvin E1
  • HY-125039
    N-Acetyl lysyltyrosylcysteine amide
    2 Publications Verification

    Glutathione Peroxidase Cardiovascular Disease Neurological Disease
    N-Acetyl lysyltyrosylcysteine amide is a potent, reversible, specific, and non-toxic tripeptide inhibitor of myeloperoxidase (MPO). N-Acetyl lysyltyrosylcysteine amide effectively inhibits MPO generation of toxic oxidants in vivo. N-Acetyl lysyltyrosylcysteine amide reduces neuronal damage and preserves brain tissue and neurological function in the stroked brain. N-Acetyl lysyltyrosylcysteine amide inhibits MPO-dependent hypochlorous acid (HOCl) generation, protein nitration, and LDL oxidation .
    N-Acetyl lysyltyrosylcysteine amide
  • HY-155959

    PD-1/PD-L1 Cancer
    PD-1/PD-L1-IN-33 (Compound N11) is a PD-1/PD-L1 inhibitor. PD-1/PD-L1-IN-33 inhibits PD-1 and PD-L1 interaction with an IC50: 6.3 nM. PD-1/PD-L1-IN-33 promotes T-cell proliferation, activation, and infiltration into tumor spheres. PD-1/PD-L1-IN-33 has immunomodulatory and anticancer activity .
    PD-1/PD-L1-IN-33
  • HY-101283
    HCH6-1
    3 Publications Verification

    Formyl Peptide Receptor (FPR) Inflammation/Immunology
    HCH6-1 is a potent and competitive dipeptide antagonist of Formyl peptide receptor 1 (FPR1). HCH6-1 inhibits chemotaxis, superoxide anion generation, and elastase release in human neutrophils specifically activated by fMLF (an FPR1 agonist). HCH6-1 has protective effects against acute lung injury (ALI) in vivo and can be used for the research of FPR1-involved inflammatory lung diseases .
    HCH6-1
  • HY-114041S1

    RvE1-d4-1

    Endogenous Metabolite Inflammation/Immunology
    Resolvin E1-d4-1 is the deuterium labeled Resolvin E1. Resolvin E1 (RvE1), a potent endogenous pro-resolving mediator of inflammation, is derived from omega-3 fatty acid eicosapentaenoic acid (EPA). Resolvin E1 is endogenously biosynthesized from EPA in the presence of Aspirin during the spontaneous resolution phase of acute inflammation, where specific cell-cell interactions occur. Resolvin E1 possesses unique counterregulatory actions that inhibit polymorphonuclear leukocyte (PMN) transendothelial migration. Resolvin E1 also acts as a potent inhibitor of leukocyte infiltration, dendritic cell migration, and IL-12 production[1][2].
    Resolvin E1-d4-1

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: