1. Peptides
  2. Peptide and Derivatives
  3. Peptide Epitopes
  4. Tag Peptides
  5. 3X HA Tag

3X HA Tag is a biological active peptide. (This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.)

For research use only. We do not sell to patients.

3X HA Tag Chemical Structure

3X HA Tag Chemical Structure

Size Price Stock Quantity
1 mg USD 265 In-stock
5 mg USD 600 In-stock
10 mg USD 900 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

3X HA Tag is a biological active peptide. (This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.)

Molecular Weight

4372.63

Formula

C205H272N38O67S

Appearance

Solid

Color

White to off-white

Sequence

Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu

Sequence Shortening

MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE

SMILES

O=C([C@@H](N)CCSC)N[C@H](C(N[C@H](C(N1[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N2[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N3[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N4[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N5[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N6[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(O)=O)CCC(O)=O)=O)CC(C)C)=O)CCCCN)=O)C)=O)C)=O)CC7=CC=C(O)C=C7)=O)CC(O)=O)=O)CCC6)=O)C(C)C)=O)CC(O)=O)=O)CC8=CC=C(O)C=C8)=O)CCC5)=O)CC9=CC=C(O)C=C9)=O)CCC(O)=O)=O)C)=O)C)=O)CC%10=CC=C(O)C=C%10)=O)CC(O)=O)=O)CCC4)=O)C(C)C)=O)CC(O)=O)=O)CC%11=CC=C(O)C=C%11)=O)CCC3)=O)CC%12=CC=C(O)C=C%12)=O)CCC(O)=O)=O)C)=O)C)=O)CC%13=CC=C(O)C=C%13)=O)CC(O)=O)=O)CCC2)=O)C(C)C)=O)CC(O)=O)=O)CC%14=CC=C(O)C=C%14)=O)CCC1)=O)CC%15=CC=C(O)C=C%15)=O)CCC(O)=O

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (22.87 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2287 mL 1.1435 mL 2.2870 mL
5 mM 0.0457 mL 0.2287 mL 0.4574 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2287 mL 1.1435 mL 2.2870 mL 5.7174 mL
5 mM 0.0457 mL 0.2287 mL 0.4574 mL 1.1435 mL
10 mM 0.0229 mL 0.1143 mL 0.2287 mL 0.5717 mL
15 mM 0.0152 mL 0.0762 mL 0.1525 mL 0.3812 mL
20 mM 0.0114 mL 0.0572 mL 0.1143 mL 0.2859 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
3X HA Tag
Cat. No.:
HY-P5491
Quantity:
MCE Japan Authorized Agent: