2. Natural Products
  3. Animals Others
  4. Exendin-3

Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn.

For research use only. We do not sell to patients.

Exendin-3 Chemical Structure

Exendin-3 Chemical Structure

CAS No. : 130357-25-4

Size Price Stock Quantity
500 μg USD 220 In-stock
1 mg USD 320 In-stock
5 mg USD 990 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Exendin-3 Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn.

IC50 & Target

VIP receptor, putative exendin receptor[1]
In Vitro

Exendin-3 interacts with at least two receptors on guinea pig pancreatic acini; at high concentrations (>100 nM) the peptide interacts with VIP receptors, thereby causing a large increase in cAMP and stimulating amylase release; at lower concentrations (0.1-3 nM) the peptide interacts with a putative exendin receptor, thereby causing a smaller increase in cAMP of undetermined function[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Exendin-3 Related Antibodies
Molecular Weight

4202.57

Formula

C184H282N50O61S
CAS No.
Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Sequence Shortening

HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
SMILES

O=C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H]([C@H](O)C)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCSC)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H](C(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC3=CNC4=CC=CC=C34)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(NCC(NCC(N5[C@@H](CCC5)C(N[C@@H](CO)C(N[C@@H](CO)C(NCC(N[C@@H](C)C(N6[C@@H](CCC6)C(N7[C@@H](CCC7)C(N8[C@@H](CCC8)C(N[C@@H](CO)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC9=CNC=N9)N
Structure Classification
Initial Source

Heloderma horridum venom
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation
References
Kinase Assay
[1]

Effect of increasing concentrations of two VIP receptor antagonists on the increase in amylase release are observed with VIP, secretin, or exendin-3. Male Hartley guinea pigs Acini were incubated with VIP (1 nM), secretin (1 μM), or Exendin-3 (1 μM) for 30 min at 37°C, alone or in combination with indicated concentrations of [AcTyr, D-Phe]GRF 1-29 amide (solid symbols) or [4-Cl-D-Phe,Leu] VIP (open symbols)[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Exendin-3 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Exendin-3130357-25-4Exendin3Exendin 3OthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Exendin-3
Cat. No.:
HY-P1543
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.