1. GPCR/G Protein
  2. PACAP Receptor
  3. PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat  (Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide 38)

Cat. No.: HY-P0221 Purity: 99.64%
COA Handling Instructions

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PACAP (1-38), human, ovine, rat Chemical Structure

PACAP (1-38), human, ovine, rat Chemical Structure

CAS No. : 137061-48-4

Size Price Stock Quantity
500 μg USD 132 In-stock
1 mg USD 176 In-stock
5 mg USD 528 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 3 publication(s) in Google Scholar

Other Forms of PACAP (1-38), human, ovine, rat:

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

IC50 & Target

IC50: 4 nM (PACAP type I receptor), 2 nM (PACAP type II receptor VIP1), and 1 nM (PACAP type II receptor VIP2)[1]

In Vitro

PACAP (1-38), human, ovine, rat is a fragment of pituitary adenylate cyclase activating polypeptide[1].
PACAP (1-38) shows high affinity for PACAP specific (PAC1) receptor in membranes from various tissues including the endocrine pancreas[2].
In vitro, PACAP (1-38) relaxes guinea-pig and rabbit tracheal smooth muscle precontracted by histamine and by acetylcholine. PACAP (1-38) also increases adenosine 3':5'-cyclic monophosphate (cyclic AMP) in tracheal smooth muscle, providing a possible mechanism for the relaxant effect of PACAP (1-38)[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

PACAP (1-38) alone in sham animals does not result in changes in any of the retinal layers. PACAP (1-38) dissolved in solutio ophthalmica cum benzalkonio leads to significant protection in the retina in bilateral common carotid artery occlusion (BCCAO)-lesioned retinas; retinas treated with PACAP (1-38) eye drops have preserved structure compared to control retinas. OLM-ILM (outer limiting membrane-inner limiting membrane) distance is reduced by 49.7% (p<0.001) in BCCAO retinas compared to sham controls, but it is only 40.6% (p<0.001) in the eyes treated with PACAP (1-38) eye drops. A protection to a similar degree is found in the inner nuclear layer (INL) (BCCAO: 38.5%, PACAP (1-38): 30.5%; p<0.001), and inner plexiform layer (IPL) (BCCAO: 64.8%, PACAP (1-38): 38.2%; p<0.05), while no statistically significant attenuation of the damage is observed in the outer nuclear layer (ONL) (BCCAO: 36.5%, PACAP (1-38): 37.7%) or outer plexiform layer (OPL) (BCCAO: 53.0%, PACAP (1-38): 48.2%). The number of cells in the ganglion cell layer (GCL) is significantly decreased after BCCAO by 52.4% (p<0.05) and is significantly ameliorated by PACAP (1-38) eye drops (decreased by 25.9%; p<0.05)[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4534.26

Formula

C203H331N63O53S

CAS No.
Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 25 mg/mL (5.51 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2205 mL 1.1027 mL 2.2054 mL
5 mM 0.0441 mL 0.2205 mL 0.4411 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
Animal Administration
[4]

Rats[4]
Wistar rats (n=20:n=12 for histological analysis, n=8 for immunohistochemical analysis) weighing 250-300 are fed and watered ad libitum, under light/dark cycles of 12/12 h. Directly after the operation within 1 min, the right eye is treated with PACAP (1-38) eye drops (1 µg/drop). The vehicle used is benzalkonium-chloride in a concentration of 0.005%, as it is the most effective vehicle to achieve neuroprotection with PACAP1-27 eye drops. The left eye serves as a control, treated only with the vehicle. A group of animals serve as the sham-operated group that undergo anesthesia and all steps of the surgical procedure except ligation of the carotid arteries. Rats are treated twice a day with one drop, for 5 consecutive days[4].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2205 mL 1.1027 mL 2.2054 mL 5.5136 mL
5 mM 0.0441 mL 0.2205 mL 0.4411 mL 1.1027 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

PACAP (1-38), human, ovine, rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PACAP (1-38), human, ovine, rat
Cat. No.:
HY-P0221
Quantity:
MCE Japan Authorized Agent: